KEGG   Homo sapiens (human): 84883Help
Entry
84883             CDS       T01001                                 

Gene name
AIFM2, AMID, PRG3
Definition
(RefSeq) apoptosis inducing factor, mitochondria associated 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q22.1
AA seq 373 aa AA seqDB search
MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETG
FAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFN
EVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALA
DKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVI
LCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGL
HANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLF
VSTSWKTMRQSPP
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggggtcccaggtctcggtggaatcgggagctctgcacgtggtgattgtgggtgggggc
tttggcgggatcgcagcagccagccagctgcaggccctgaacgtccccttcatgctggtg
gacatgaaggactccttccaccacaatgtggctgctctccgagcctccgtggagacaggg
ttcgccaaaaagacattcatttcttactcggtgactttcaaggacaacttccggcagggg
ctagtagtggggatagacctgaagaaccagatggtgctgctgcagggtggcgaggccctg
cccttctctcatcttatcctggccacgggcagcactgggcccttcccgggcaagtttaat
gaggtttccagccagcaggccgctatccaggcctatgaggacatggtgaggcaggtccag
cgctcacggttcatcgtggtggtgggaggaggctcggctggagtggagatggcagcagag
attaaaacagaatatcctgagaaagaggtcactctcattcactcccaagtggccctggct
gacaaggagctcctgccctccgtccggcaggaagtgaaggagatcctcctccggaagggc
gtgcagctgctgctgagtgagcgggtgagcaatctggaggagctgcctctcaatgagtat
cgagagtacatcaaagtgcagacggacaaaggcacagaggtggccaccaacctggtgatt
ctctgcaccggcatcaagatcaacagctccgcctaccgcaaagcgtttgagagcagacta
gccagcagtggtgctctgagagtgaacgagcacctccaggtggagggccacagcaacgtc
tacgccattggtgactgtgccgacgtgaggacgcccaagatggcctatcttgccggcctc
cacgccaacatcgccgtggccaacatcgtcaactctgtgaagcagcggcctctccaggcc
tacaagccgggtgcactgacgttcctcctgtccatggggagaaatgacggtgtgggccaa
atcagtggcttctatgtgggccggctcatggttcggctgaccaagagccgggacctgttc
gtctctacgagctggaaaaccatgaggcagtctccaccttga

DBGET integrated database retrieval system