KEGG   Homo sapiens (human): 84890Help
Entry
84890             CDS       T01001                                 

Gene name
ADO, C10orf22
Definition
(RefSeq) 2-aminoethanethiol dioxygenase
  KO
K10712  cysteamine dioxygenase [EC:1.13.11.19]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00430  Taurine and hypotaurine metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    84890 (ADO)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.19  cysteamine dioxygenase
     84890 (ADO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCO_ADO CDO_I
Motif
Other DBs
NCBI-GeneID: 84890
NCBI-ProteinID: NP_116193
OMIM: 611392
HGNC: 23506
Ensembl: ENSG00000181915
Vega: OTTHUMG00000018306
Pharos: Q96SZ5(Tbio)
UniProt: Q96SZ5 B3KXN9
Position
10q21.3
AA seq 270 aa AA seqDB search
MPRDNMASLIQRIARQACLTFRGSGGGRGASDRDAASGPEAPMQPGFPENLSKLKSLLTQ
LRAEDLNIAPRKATLQPLPPNLPPVTYMHIYETDGFSLGVFLLKSGTSIPLHDHPGMHGM
LKVLYGTVRISCMDKLDAGGGQRPRALPPEQQFEPPLQPREREAVRPGVLRSRAEYTEAS
GPCILTPHRDNLHQIDAVEGPAAFLDILAPPYDPDDGRDCHYYRVLEPVRPKEASSSACD
LPREVWLLETPQADDFWCEGEPYPGPKVFP
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgccccgagacaacatggcctccttgatccaacggatcgcccgccaggcttgcctcacc
ttccggggcagcgggggcggccgcggcgcttccgatcgcgacgcggcttctggcccggag
gcgccgatgcagccgggcttccccgagaacctgagcaagctgaagagcctcctgacccag
ctccgcgccgaggacttgaacatcgccccgcgcaaggccacactgcagccgctgccgccc
aacctgccgccagtcacctacatgcacatctacgagacggacggcttcagcctgggcgtg
ttcctgctcaagagcggcacgtccatcccgctgcacgaccacccgggcatgcacggcatg
ctcaaggtgctgtacggcaccgtgcgcatcagctgcatggacaagctagacgcgggcggc
gggcaacggccgcgggccttgccgcccgagcagcagttcgagccgccgctgcagccccgg
gagcgagaagccgtgcggccgggcgtgctgcgttcgcgggccgagtacaccgaggccagc
ggcccctgcatcctcacaccgcaccgggacaacctgcaccagatcgacgccgtggaaggg
cctgccgccttcctggacatcctggccccgccctacgacccggacgatggccgggactgc
cactattaccgggtgctggagccggtcaggcccaaggaggcctccagctcggcctgtgac
ctgcctcgagaggtgtggctcctggagaccccacaggccgatgacttctggtgcgaggga
gaaccctatccaggtcccaaggtcttcccttga

DBGET integrated database retrieval system