KEGG   Homo sapiens (human): 84890Help
Entry
84890             CDS       T01001                                 

Gene name
ADO, C10orf22
Definition
2-aminoethanethiol (cysteamine) dioxygenase (EC:1.13.11.19)
Orthology
K10712  
cysteamine dioxygenase [EC:1.13.11.19]
Organism
hsa  Homo sapiens (human)
Pathway
Taurine and hypotaurine metabolism
Metabolic pathways
Class
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:hsa00430]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q21.3
AA seq 270 aa AA seqDB search
MPRDNMASLIQRIARQACLTFRGSGGGRGASDRDAASGPEAPMQPGFPENLSKLKSLLTQ
LRAEDLNIAPRKATLQPLPPNLPPVTYMHIYETDGFSLGVFLLKSGTSIPLHDHPGMHGM
LKVLYGTVRISCMDKLDAGGGQRPRALPPEQQFEPPLQPREREAVRPGVLRSRAEYTEAS
GPCILTPHRDNLHQIDAVEGPAAFLDILAPPYDPDDGRDCHYYRVLEPVRPKEASSSACD
LPREVWLLETPQADDFWCEGEPYPGPKVFP
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgccccgagacaacatggcctccttgatccaacggatcgcccgccaggcttgcctcacc
ttccggggcagcgggggcggccgcggcgcttccgatcgcgacgcggcttctggcccggag
gcgccgatgcagccgggcttccccgagaacctgagcaagctgaagagcctcctgacccag
ctccgcgccgaggacttgaacatcgccccgcgcaaggccacactgcagccgctgccgccc
aacctgccgccagtcacctacatgcacatctacgagacggacggcttcagcctgggcgtg
ttcctgctcaagagcggcacgtccatcccgctgcacgaccacccgggcatgcacggcatg
ctcaaggtgctgtacggcaccgtgcgcatcagctgcatggacaagctagacgcgggcggc
gggcaacggccgcgggccttgccgcccgagcagcagttcgagccgccgctgcagccccgg
gagcgagaagccgtgcggccgggcgtgctgcgttcgcgggccgagtacaccgaggccagc
ggcccctgcatcctcacaccgcaccgggacaacctgcaccagatcgacgccgtggaaggg
cctgccgccttcctggacatcctggccccgccctacgacccggacgatggccgggactgc
cactattaccgggtgctggagccggtcaggcccaaggaggcctccagctcggcctgtgac
ctgcctcgagaggtgtggctcctggagaccccacaggccgatgacttctggtgcgaggga
gaaccctatccaggtcccaaggtcttcccttga

DBGET integrated database retrieval system