KEGG   Homo sapiens (human): 8491Help
Entry
8491              CDS       T01001                                 

Gene name
MAP4K3, GLK, MAPKKKK3, MEKKK_3, MEKKK3, RAB8IPL1
Definition
mitogen-activated protein kinase kinase kinase kinase 3 (EC:2.7.11.1)
Orthology
K04406  
mitogen-activated protein kinase kinase kinase kinase 3 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p22.1
AA seq 873 aa AA seqDB search
MNPGFDLSRRNPQEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIKLEPGEDFAVVQQ
EIIMMKDCKHPNIVAYFGSYLRRDKLWICMEFCGGGSLQDIYHVTGPLSELQIAYVSRET
LQGLYYLHSKGKMHRDIKGANILLTDNGHVKLADFGVSAQITATIAKRKSFIGTPYWMAP
EVAAVERKGGYNQLCDLWAVGITAIELAELQPPMFDLHPMRALFLMTKSNFQPPKLKDKM
KWSNSFHHFVKMALTKNPKKRPTAEKLLQHPFVTQHLTRSLAIELLDKVNNPDHSTYHDF
DDDDPEPLVAVPHRIHSTSRNVREEKTRSEITFGQVKFDPPLRKETEPHHELDLQLEYGQ
GHQGGYFLGANKSLLKSVEEELHQRGHVAHLEDDEGDDDESKHSTLKAKIPPPLPPKPKS
IFIPQEMHSTEDENQGTIKRCPMSGSPAKPSQVPPRPPPPRLPPHKPVALGNGMSSFQLN
GERDGSLCQQQNEHRGTNLSRKEKKDVPKPISNGLPPTPKVHMGACFSKVFNGCPLKIHC
ASSWINPDTRDQYLIFGAEEGIYTLNLNELHETSMEQLFPRRCTWLYVMNNCLLSISGKA
SQLYSHNLPGLFDYARQMQKLPVAIPAHKLPDRILPRKFSVSAKIPETKWCQKCCVVRNP
YTGHKYLCGALQTSIVLLEWVEPMQKFMLIKHIDFPIPCPLRMFEMLVVPEQEYPLVCVG
VSRGRDFNQVVRFETVNPNSTSSWFTESDTPQTNVTHVTQLERDTILVCLDCCIKIVNLQ
GRLKSSRKLSSELTFDFQIESIVCLQDSVLAFWKHGMQGRSFRSNEVTQEISDSTRIFRL
LGSDRVVVLESRPTDNPTANSNLYILAGHENSY
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccggcttcgatttgtcccgccggaacccgcaggaggacttcgagctgattcag
cgcatcggcagcggcacctacggcgacgtctacaaggcacggaatgttaacactggtgaa
ttagcagcaattaaagtaataaaattggaaccaggagaagactttgcagttgtgcagcaa
gaaattattatgatgaaagactgtaaacacccaaatattgttgcttattttggaagctat
ctcaggcgagataagctttggatttgcatggagttttgtggaggtggttctttacaggat
atttatcacgtaactggacctctgtcagaactgcaaattgcatatgttagcagagaaaca
ctgcagggattatattatcttcacagtaaaggaaaaatgcacagagatataaagggagct
aacattctattaacggataatggtcatgtgaaattggctgattttggagtatctgcacag
ataacagctacaattgccaaacggaagtctttcattggcacaccatattggatggctcca
gaagttgcagctgttgagaggaaggggggttacaatcaactctgtgatctctgggcagtg
ggaatcactgccatagaacttgcagagcttcagcctcctatgtttgacttacacccaatg
agagcattatttctaatgacaaaaagcaattttcagcctcctaaactaaaggataaaatg
aaatggtcaaatagttttcatcactttgtgaaaatggcacttaccaaaaatccgaaaaaa
agacctactgctgaaaaattattacagcatccttttgtaacacaacatttgacacggtct
ttggcaatcgagctgttggataaagtaaataatccagatcattccacttaccatgatttc
gatgatgatgatcctgagcctcttgttgctgtaccacatagaattcactcaacaagtaga
aacgtgagagaagaaaaaacacgctcagagataacctttggccaagtgaaatttgatcca
cccttaagaaaggagacagaaccacatcatgaacttgatctgcaactggaatatggacaa
ggacaccaaggtggttactttttaggtgcaaacaagagtcttctcaagtctgttgaagaa
gaattgcatcagcgaggacacgtcgcacatttagaagatgatgaaggagatgatgatgaa
tctaaacactcaactctgaaagcaaaaattccacctcctttgccaccaaagcctaagtct
atcttcataccacaggaaatgcattctactgaggatgaaaatcaaggaacaatcaagaga
tgtcccatgtcagggagcccagcaaagccatcccaagttccacctagaccaccacctccc
agattacccccacacaaacctgttgccttaggaaatggaatgagctccttccagttaaat
ggtgaacgagatggctcattatgtcaacaacagaatgaacatagaggcacaaacctttca
agaaaagaaaagaaagatgtaccaaagcctattagtaatggtcttcctccaacacctaaa
gtgcatatgggtgcatgtttttcaaaagtttttaatgggtgtcccttgaaaattcactgt
gcatcatcatggataaacccagatacaagagatcagtacttgatatttggtgccgaagaa
gggatttataccctcaatcttaatgaacttcatgaaacatcaatggaacagctattccct
cgaaggtgtacatggttgtatgtaatgaacaattgcttgctatcaatatctggtaaagct
tctcagctttattcccataatttaccagggctttttgattatgcaagacaaatgcaaaag
ttacctgttgctattccagcacacaaactccctgacagaatactgccaaggaaattttct
gtatcagcaaaaatccctgaaaccaaatggtgccagaagtgttgtgttgtaagaaatcct
tacacgggccataaatacctatgtggagcacttcagactagcattgttctattagaatgg
gttgaaccaatgcagaaatttatgttaattaagcacatagattttcctataccatgtcca
cttagaatgtttgaaatgctggtagttcctgaacaggagtaccctttagtttgtgttggt
gtcagtagaggtagagacttcaaccaagtggttcgatttgagacggtcaatccaaattct
acctcttcatggtttacagaatcagataccccacagacaaatgttactcatgtaacccaa
ctggagagagataccatccttgtatgcttggactgttgtataaaaatagtaaatctccaa
ggaagattaaaatctagcaggaaattgtcatcagaactcacctttgatttccagattgaa
tcaatagtgtgcctacaagacagtgtgctagctttctggaaacatggaatgcaaggtaga
agttttagatctaatgaggtaacacaagaaatttcagatagcacaagaattttcaggctg
cttggatctgacagggtcgtggttttggaaagtaggccaactgataaccccacagcaaat
agcaatttgtacatcctggcgggtcatgaaaacagttactga

DBGET integrated database retrieval system