KEGG   Homo sapiens (human): 84916Help
Entry
84916             CDS       T01001                                 

Gene name
UTP4, CIRH1A, CIRHIN, NAIC, TEX292
Definition
(RefSeq) UTP4, small subunit processome component
  KO
K14548  
U3 small nucleolar RNA-associated protein 4
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Disease
H00624  
Familial cholestasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    84916 (UTP4)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  90S particles
   U3 small nucleolar RNA-associated proteins
    84916 (UTP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q969X6(Tbio)
UniProt: 
Position
16q22.1
AA seq 686 aa AA seqDB search
MGEFKVHRVRFFNYVPSGIRCVAYNNQSNRLAVSRTDGTVEIYNLSANYFQEKFFPGHES
RATEALCWAEGQRLFSAGLNGEIMEYDLQALNIKYAMDAFGGPIWSMAASPSGSQLLVGC
EDGSVKLFQITPDKIQFERNFDRQKSRILSLSWHPSGTHIAAGSIDYISVFDVKSGSAVH
KMIVDRQYMGVSKRKCIVWGVAFLSDGTIISVDSAGKVQFWDSATGTLVKSHLIANADVQ
SIAVADQEDSFVVGTAEGTVFHFQLVPVTSNSSEKQWVRTKPFQHHTHDVRTVAHSPTAL
ISGGTDTHLVFRPLMEKVEVKNYDAALRKITFPHRCLISCSKKRQLLLFQFAHHLELWRL
GSTVATGKNGDTLPLSKNADHLLHLKTKGPENIICSCISPCGSWIAYSTVSRFFLYRLNY
EHDNISLKRVSKMPAFLRSALQILFSEDSTKLFVASNQGALHIVQLSGGSFKHLHAFQPQ
SGTVEAMCLLAVSPDGNWLAASGTSAGVHVYNVKQLKLHCTVPAYNFPVTAMAIAPNTNN
LVIAHSDQQVFEYSIPDKQYTDWSRTVQKQGFHHLWLQRDTPITHISFHPKRPMHILLHD
AYMFCIIDKSLPLPNDKTLLYNPFPPTNESDVIRRRTAHAFKISKIYKPLLFMDLLDERT
LVAVERPLDDIIAQLPPPIKKKKFGT
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaatttaaggtccatcgagtacgtttctttaattatgttccatcaggaatccgc
tgtgtggcttacaataaccagtcaaacagattggctgtttcacgaacagatggcactgtg
gaaatttataacttgtcagcaaactactttcaggagaaatttttcccaggtcatgagtct
cgggctacagaagctttgtgctgggcagaaggacagcgactctttagtgctgggctcaat
ggcgagattatggagtatgatttacaggcgttaaacatcaagtatgctatggatgccttt
ggaggacctatttggagcatggctgccagccccagtggctctcaacttttggttggttgt
gaagatggatctgtgaaactatttcaaattaccccagacaaaatccagtttgaaagaaat
tttgatcggcagaaaagtcgcatcctgagtctcagctggcatccctctggtacccacatt
gcagctggttccatagactacattagtgtgtttgatgtcaaatcaggcagcgctgttcat
aagatgattgtggacaggcagtatatgggcgtgtctaagcggaagtgcatcgtgtggggt
gtcgccttcttgtccgatggcactatcataagtgtggactctgctgggaaggtgcagttc
tgggactcagccactgggacgcttgtgaagagccatctcatcgctaatgctgacgtgcag
tccattgctgtagctgaccaagaagacagtttcgtggtgggcacagccgagggaacagtc
ttccattttcagctggtccctgtgacatctaacagcagtgagaagcagtgggtgcggaca
aaaccgttccagcatcacactcatgacgtgcgcactgtggcccacagcccaacagcgctg
atatctggaggcactgacacccacttagtctttcgtcctctcatggagaaggtggaagta
aagaattacgatgccgctctccgaaaaatcacctttccccaccgatgtctcatctcctgt
tctaaaaagaggcagcttctcctcttccagtttgctcatcacttagaactttggcgactg
ggatccacagttgcaacaggcaagaatggggatactcttccactctctaaaaatgcagat
catttactgcacctaaagacaaagggtcctgagaacattatctgtagctgtatctcccca
tgtggaagttggatagcctattctacagtttctcggttttttctctatcggctgaattat
gaacatgacaacataagcctcaaaagggtttccaaaatgccagcattccttcgctctgcc
cttcagattttgttttctgaagattcaacaaagctctttgtagcatcaaatcaaggagct
ctgcatattgttcagctgtcaggaggaagcttcaagcacctgcatgctttccagcctcag
tcaggaacagtggaggccatgtgtcttttggcagtcagtccagatgggaattggctagct
gcatcaggtaccagtgctggagtccatgtctacaacgtaaaacagctaaagcttcactgc
acggtgcctgcttacaatttcccagtgactgctatggctattgcccccaataccaacaac
cttgtcatcgctcattcggaccagcaggtatttgagtacagcatcccagacaaacagtat
acagattggagccggactgtccagaagcagggctttcaccacctttggctccaaagggat
actcctatcacacacatcagttttcatcccaagagaccgatgcacatccttctccatgat
gcctacatgttctgcatcattgacaagtcattgccccttccaaatgacaaaaccttactc
tacaatccatttcctcccacgaatgaatcagatgtcatccggaggcgcacagctcatgct
tttaaaatttctaagatatataagcctctactcttcatggatcttttggatgaaagaaca
ctcgtggcagtagaacggcctctggatgacatcattgctcagctcccaccacccattaaa
aagaagaaatttggaacctaa

DBGET integrated database retrieval system