KEGG   Homo sapiens (human): 84923Help
Entry
84923             CDS       T01001                                 

Gene name
FAM104A
Definition
(RefSeq) family with sequence similarity 104 member A
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q25.1
AA seq 186 aa AA seqDB search
MGGRGADAGSSGGTGPTEGYSPPAASTRAAARAKARGGGRGGRRNTTPSVPSLRGAAPRS
FHPPAAMSERLRPRKRRRNGNEEDNHLPPQTKRSSRNPVFQDSWDTESSGSDSGGSSSSS
SSSINSPDRASGPEGSLSQTMAGSSPNTPQPVPEQSALCQGLYFHINQTLREAHFHSLQH
RGRPLT
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgggggggcgcggagcagacgccggaagtagtggtggtacgggtccgactgaggggtac
tcgccaccggctgcgtccacccgagcggctgcgagagccaaggcccgagggggtgggcgt
ggcggccgccgaaacacaaccccctctgttccctctcttcgcggagcggcgccgcgtagc
ttccatccgccagctgccatgagcgagcgcctccgtcccaggaaaaggagaaggaatggc
aacgaagaagacaaccatcttcccccccagaccaaaagaagtagcagaaaccctgtcttt
caggattcctgggacacagagtcttcaggcagtgacagtggtgggagcagcagcagcagc
agcagcagcatcaatagcccggacagggccagcgggccggaaggcagcttgagccagacc
atggccggatccagccctaacacgcctcagcccgtgcccgagcagtccgcgctgtgccaa
ggcctctacttccacatcaaccagaccctgagggaggcccacttccacagcctacagcac
cgagggcggcctctgacatga

DBGET integrated database retrieval system