KEGG   Homo sapiens (human): 84923Help
Entry
84923             CDS       T01001                                 

Gene name
FAM104A
Definition
(RefSeq) family with sequence similarity 104 member A
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: FAM104
Motif
Other DBs
NCBI-GeneID: 84923
NCBI-ProteinID: NP_116226
HGNC: 25918
Ensembl: ENSG00000133193
Vega: OTTHUMG00000150564
Pharos: Q969W3(Tdark)
UniProt: Q969W3
Position
17q25.1
AA seq 186 aa AA seqDB search
MGGRGADAGSSGGTGPTEGYSPPAASTRAAARAKARGGGRGGRRNTTPSVPSLRGAAPRS
FHPPAAMSERLRPRKRRRNGNEEDNHLPPQTKRSSRNPVFQDSWDTESSGSDSGGSSSSS
SSSINSPDRASGPEGSLSQTMAGSSPNTPQPVPEQSALCQGLYFHINQTLREAHFHSLQH
RGRPLT
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgggggggcgcggagcagacgccggaagtagtggtggtacgggtccgactgaggggtac
tcgccaccggctgcgtccacccgagcggctgcgagagccaaggcccgagggggtgggcgt
ggcggccgccgaaacacaaccccctctgttccctctcttcgcggagcggcgccgcgtagc
ttccatccgccagctgccatgagcgagcgcctccgtcccaggaaaaggagaaggaatggc
aacgaagaagacaaccatcttcccccccagaccaaaagaagtagcagaaaccctgtcttt
caggattcctgggacacagagtcttcaggcagtgacagtggtgggagcagcagcagcagc
agcagcagcatcaatagcccggacagggccagcgggccggaaggcagcttgagccagacc
atggccggatccagccctaacacgcctcagcccgtgcccgagcagtccgcgctgtgccaa
ggcctctacttccacatcaaccagaccctgagggaggcccacttccacagcctacagcac
cgagggcggcctctgacatga

DBGET integrated database retrieval system