KEGG   Homo sapiens (human): 84930Help
Entry
84930             CDS       T01001                                 

Gene name
MASTL, GREATWALL, GW, GWL, MAST-L, THC2
Definition
(RefSeq) microtubule associated serine/threonine kinase like (EC:2.7.11.1)
  KO
K16309  
serine/threonine-protein kinase greatwall [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Disease
H00978  
Thrombocytopenia (THC)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     84930 (MASTL)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  MAST family [OT]
   84930 (MASTL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10p12.1
AA seq 879 aa AA seqDB search
MDPTAGSKKEPGGGAATEEGVNRIAVPKPPSIEEFSIVKPISRGAFGKVYLGQKGGKLYA
VKVVKKADMINKNMTHQVQAERDALALSKSPFIVHLYYSLQSANNVYLVMEYLIGGDVKS
LLHIYGYFDEEMAVKYISEVALALDYLHRHGIIHRDLKPDNMLISNEGHIKLTDFGLSKV
TLNRDINMMDILTTPSMAKPRQDYSRTPGQVLSLISSLGFNTPIAEKNQDPANILSACLS
ETSQLSQGLVCPMSVDQKDTTPYSSKLLKSCLETVASNPGMPVKCLTSNLLQSRKRLATS
SASSQSHTFISSVESECHSSPKWEKDCQESDEALGPTMMSWNAVEKLCAKSANAIETKGF
NKKDLELALSPIHNSSALPTTGRSCVNLAKKCFSGEVSWEAVELDVNNINMDTDTSQLGF
HQSNQWAVDSGGISEEHLGKRSLKRNFELVDSSPCKKIIQNKKTCVEYKHNEMTNCYTNQ
NTGLTVEVQDLKLSVHKSQQNDCANKENIVNSFTDKQQTPEKLPIPMIAKNLMCELDEDC
EKNSKRDYLSSSFLCSDDDRASKNISMNSDSSFPGISIMESPLESQPLDSDRSIKESSFE
ESNIEDPLIVTPDCQEKTSPKGVENPAVQESNQKMLGPPLEVLKTLASKRNAVAFRSFNS
HINASNNSEPSRMNMTSLDAMDISCAYSGSYPMAITPTQKRRSCMPHQQTPNQIKSGTPY
RTPKSVRRGVAPVDDGRILGTPDYLAPELLLGRAHGPAVDWWALGVCLFEFLTGIPPFND
ETPQQVFQNILKRDIPWPEGEEKLSDNAQSAVEILLTIDDTKRAGMKELKRHPLFSDVDW
ENLQHQTMPFIPQPDDETDTSYFEARNTAQHLTVSGFSL
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atggatcccaccgcgggaagcaagaaggagcctggaggaggcgcggcgactgaggagggc
gtgaataggatcgcagtgccaaaaccgccctccattgaggaattcagcatagtgaagccc
attagccggggcgccttcgggaaagtgtatctggggcagaaaggcggcaaattgtatgca
gtaaaggttgttaaaaaagcagacatgatcaacaaaaatatgactcatcaggtccaagct
gagagagatgcactggcactaagcaaaagcccattcattgtccatttgtattattcactg
cagtctgcaaacaatgtctacttggtaatggaatatcttattgggggagatgtcaagtct
ctcctacatatatatggttattttgatgaagagatggctgtgaaatatatttctgaagta
gcactggctctagactaccttcacagacatggaatcatccacagggacttgaaaccggac
aatatgcttatttctaatgagggtcatattaaactgacggattttggcctttcaaaagtt
actttgaatagagatattaatatgatggatatccttacaacaccatcaatggcaaaacct
agacaagattattcaagaaccccaggacaagtgttatcgcttatcagctcgttgggattt
aacacaccaattgcagaaaaaaatcaagaccctgcaaacatcctttcagcctgtctgtct
gaaacatcacagctttctcaaggactcgtatgccctatgtctgtagatcaaaaggacact
acgccttattctagcaaattactaaaatcatgtcttgaaacagttgcctccaacccagga
atgcctgtgaagtgtctaacttctaatttactccagtctaggaaaaggctggccacatcc
agtgccagtagtcaatcccacaccttcatatccagtgtggaatcagaatgccacagcagt
cccaaatgggaaaaagattgccaggaaagtgatgaagcattgggcccaacaatgatgagt
tggaatgcagttgaaaagttatgcgcaaaatctgcaaatgccattgagacgaaaggtttc
aataaaaaggatctggagttagctctttctcccattcataacagcagtgcccttcccacc
actggacgctcttgtgtaaaccttgctaaaaaatgcttctctggggaagtttcttgggaa
gcagtagaactggatgtaaataatataaatatggacactgacacaagtcagttaggtttc
catcagtcaaatcagtgggctgtggattctggtgggatatctgaagagcaccttgggaaa
agaagtttaaaaagaaattttgagttggttgactccagtccttgtaaaaaaattatacag
aataaaaaaacttgtgtagagtataagcataacgaaatgacaaattgttatacaaatcaa
aatacaggcttaacagttgaagtgcaggaccttaagctatcagtgcacaaaagtcaacaa
aatgactgtgctaataaggagaacattgtcaattcttttactgataaacaacaaacacca
gaaaaattacctataccaatgatagcaaaaaaccttatgtgtgaactcgatgaagactgt
gaaaagaatagtaagagggactacttaagttctagttttctatgttctgatgatgataga
gcttctaaaaatatttctatgaactctgattcatcttttcctggaatttctataatggaa
agtccattagaaagtcagcccttagattcagatagaagcatcaaagaatcctcttttgaa
gaatcaaatattgaagatccacttattgtaacaccagattgccaagaaaagacctcacca
aaaggtgtcgagaaccctgctgtacaagagagtaaccaaaaaatgttaggtcctcctttg
gaggtgctgaaaacgttagcctctaaaagaaatgctgttgcttttcgaagttttaacagt
catattaatgcatccaataactcagaaccatccagaatgaacatgacttctttagatgca
atggatatttcgtgtgcctacagtggttcatatcccatggctataacccctactcaaaaa
agaagatcctgtatgccacatcagcagaccccaaatcagatcaagtcgggaactccatac
cgaactccgaagagtgtgagaagaggggtggcccccgttgatgatgggcgaattctagga
accccagactaccttgcacctgagctgttactaggcagggcccatggtcctgcggtagac
tggtgggcacttggagtttgcttgtttgaatttctaacaggaattccccctttcaatgat
gaaacaccacaacaagtattccagaatattctgaaaagagatatcccttggccagaaggt
gaagaaaagttatctgataatgctcaaagtgcagtagaaatacttttaaccattgatgat
acaaagagagctggaatgaaagagctaaaacgtcatcctctcttcagtgatgtggactgg
gaaaatctgcagcatcagactatgcctttcatcccccagccagatgatgaaacagatacc
tcctattttgaagccaggaatactgctcagcacctgactgtatctggatttagtctgtag

DBGET integrated database retrieval system