KEGG   Homo sapiens (human): 84946Help
Entry
84946             CDS       T01001                                 

Gene name
LTV1, C6orf93, dJ468K18.4
Definition
(RefSeq) LTV1 ribosome biogenesis factor
  KO
K14798  
protein LTV1
Organism
hsa  Homo sapiens (human)
Brite
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    84946 (LTV1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q24.2
AA seq 475 aa AA seqDB search
MPHRKKKPFIEKKKAVSFHLVHRSQRDPLAADESAPQRVLLPTQKIDNEERRAEQRKYGV
FFDDDYDYLQHLKEPSGPSELIPSSTFSAHNRREEKEETLVIPSTGIKLPSSVFASEFEE
DVGLLNKAAPVSGPRLDFDPDIVAALDDDFDFDDPDNLLEDDFILQANKATGEEEGMDIQ
KSENEDDSEWEDVDDEKGDSNDDYDSAGLLSDEDCMSVPGKTHRAIADHLFWSEETKSRF
TEYSMTSSVMRRNEQLTLHDERFEKFYEQYDDDEIGALDNAELEGSIQVDSNRLQEVLND
YYKEKAENCVKLNTLEPLEDQDLPMNELDESEEEEMITVVLEEAKEKWDCESICSTYSNL
YNHPQLIKYQPKPKQIRISSKTGIPLNVLPKKGLTAKQTERIQMINGSDLPKVSTQPRSK
NESKEDKRARKQAIKEERKERRVEKKANKLAFKLEKRRQEKELLNLKKNVEGLKL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcctcacaggaagaaaaagccctttatagagaagaagaaagctgtgtcttttcacttg
gtccaccggagccaacgagatcctttagcagcagatgagagtgcaccccagagggttcta
ttgcccacacaaaaaatagacaatgaagaaaggcgagcagaacagaggaagtatggagtg
ttctttgatgacgactatgactacctgcagcacctgaaggaaccatctgggccttcagag
cttattccctcaagtaccttcagtgcacacaacaggagagaggagaaagaagaaacgcta
gtaattccaagcactggaattaagttgccttcatcagtgtttgcttcagagtttgaggaa
gatgttggattgttaaataaagcagctccagtttcaggacctcgactggattttgatcct
gacattgttgcagctcttgatgatgattttgactttgatgatccagataatctgcttgag
gatgactttattcttcaggccaataaggcaacaggagaggaagagggaatggatatacag
aaatctgagaatgaagatgacagcgagtgggaagatgtggatgatgagaagggagatagc
aatgatgactatgactctgcaggcctattgtcagatgaagactgtatgtctgtgcccgga
aaaactcacagagctatagcagatcacttgttctggagtgaggaaacaaagagtcgcttc
acggagtattcgatgacttcctcagtcatgaggagaaatgaacagctgaccctacatgat
gagaggtttgagaagttttatgagcaatatgatgatgatgaaattggagctctggataat
gcagaattggaaggttctattcaagtggacagcaatcgcttacaggaagttttgaatgac
tactataaagagaaggcagagaattgtgtaaaattgaatacccttgaacccttggaggat
caagacctgccaatgaatgagcttgatgagtctgaggaggaagaaatgattactgtagtc
cttgaagaagccaaagagaagtgggattgtgaatctatttgtagtacatactcaaattta
tataaccatccacagcttatcaagtatcaaccaaagcccaaacaaattcgaatatcttct
aaaacaggaatacctctcaatgtcttaccaaagaaaggactcacagcaaagcaaactgaa
agaatacagatgattaatggcagtgatcttcctaaagtatcaactcagccacgttctaaa
aatgaaagcaaagaagataaaagagcaagaaagcaagctataaaagaagagcgcaaggaa
cgaagagtggagaagaaagctaacaaattagcatttaaactggagaaaagaaggcaagaa
aaagagctgctgaacttgaagaagaatgttgagggtctaaagctatag

DBGET integrated database retrieval system