KEGG   Homo sapiens (human): 84957Help
Entry
84957             CDS       T01001                                 

Gene name
RELT, TNFRSF19L, TRLT
Definition
RELT tumor necrosis factor receptor
Orthology
K05156  
tumor necrosis factor receptor superfamily member 19-like
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    84957 (RELT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13.4
AA seq 430 aa AA seqDB search
MKPSLLCRPLSCFLMLLPWPLATLTSTTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAW
GSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHG
CDEWGRRARRGVEVAAGASSGGETRQPGNGTRAGGPEETAAQYAVIAIVPVFCLMGLLGI
LVCNLLKRKGYHCTAHKEVGPGPGGGGSGINPAYRTEDANEDTIGVLVRLITEKKENAAA
LEELLKEYHSKQLVQTSHRPVSKLPPAPPNVPHICPHRHHLHTVQGLASLSGPCCSRCSQ
KKWPEVLLSPEAVAATTPVPSLLPNPTRVPKAGAKAGRQGEITILSVGRFRVARIPEQRT
SSMVSEVKTITEAGPSWGDLPDSPQPGLPPEQQALLGSGGSRTKWLKPPAENKAEENRYV
VRLSESNLVI
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaagtctgctgtgccggcccctgtcctgcttccttatgctgctgccctggcct
ctcgccaccctgacatcaacaaccctttggcagtgcccacctggggaggagcccgacctg
gacccagggcagggcacattatgcaggccctgccccccaggcaccttctcagctgcatgg
ggctccagcccatgccagccccatgcccgttgcagcctttggaggaggctggaggcccag
gtgggcatggcaactcgagatacactctgtggagactgctggcctgggtggtttgggcct
tggggggttccccgcgttccatgtcaaccatgttcctgggcacctctgggtactcatggc
tgtgatgagtgggggcggcgggcccgacgtggcgtggaggtggcagcaggggccagcagc
ggtggtgagacacggcagcctgggaacggcacccgggcaggtggcccagaggagacagcc
gcccagtacgcggtcatcgccatcgtccctgtcttctgcctcatggggctgttgggcatc
ctggtgtgcaacctcctcaagcggaagggctaccactgcacggcgcacaaggaggtcggg
cccggccctggaggtggaggcagtggaatcaaccctgcctaccggactgaggatgccaat
gaggacaccattggggtcctggtgcgcttgatcacagagaagaaagagaatgctgcggcc
ctggaggagctgctgaaagagtaccacagcaaacagctggtgcagacgagccacaggcct
gtgtccaagctgccgccagcgcccccgaacgtgccacacatctgcccgcaccgccaccat
ctccacaccgtgcagggcctggcctcgctctctggcccctgctgctcccgctgtagccag
aagaagtggcccgaggtgctgctgtcccctgaggctgtagccgccactactcctgttccc
agccttctgcctaacccgaccagggttcccaaggccggggccaaggcagggcgtcagggc
gagatcaccatcttgtctgtgggcaggttccgcgtggctcgaattcctgagcagcggaca
agttcaatggtgtctgaggtgaagaccatcacggaggctgggccctcgtggggtgatctc
cctgactccccacagcctggcctcccccctgagcagcaggccctgctaggaagtggcgga
agccgtacaaagtggctgaagcccccagcagagaacaaggccgaggagaaccgctatgtg
gtccggctaagtgagagcaacctggtcatctga

DBGET integrated database retrieval system