KEGG   Homo sapiens (human): 84971Help
Entry
84971             CDS       T01001                                 

Gene name
ATG4D, APG4-D, APG4D, AUTL4
Definition
autophagy related 4D, cysteine peptidase
Orthology
K08342  
cysteine protease ATG4 [EC:3.4.22.-]
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of autophagy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    84971 (ATG4D)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     84971 (ATG4D)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C54: Aut2 peptidase family
   84971 (ATG4D)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    84971 (ATG4D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.2
AA seq 411 aa AA seqDB search
MQVLHLAGRCPYVSPGWVVKSRTSFSKISSIHLCGRRYRFEGEGDIQRFQRDFVSRLWLT
YRRDFPPLPGGCLTSDCGWGCMLRSGQMMLAQGLLLHFLPRDWTWAEGMGLGPPELSGSA
SPSRYHGPARWMPPRWAQGAPELEQERRHRQIVSWFADHPRAPFGLHRLVELGQSSGKKA
GDWYGPSLVAHILRKAVESCSDVTRLVVYVSQDCTVYKADVARLVARPDPTAEWKSVVIL
VPVRLGGETLNPVYVPCVKELLRCELCLGIMGGKPRHSLYFIGYQDDFLLYLDPHYCQPT
VDVSQADFPLESFHCTSPRKMAFAKMDPSCTVGFYAGDRKEFETLCSELTRVLSSSSATE
RYPMFTLAEGHAQDHSLDDLCSQLAQPTLRLPRTGRLLRAKRPSSEDFVFL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtgcttcatctcgctgggcgctgcccctacgtctccccaggttgggtggttaaa
agccggaccagctttagcaagatctccagcatccacctctgtggccgccgctaccgtttc
gagggcgagggtgacatacagcgtttccagcgggactttgtgtcccgcctgtggctcaca
taccgccgggacttcccgccccttcctgggggctgcctgacctcggactgtggctggggg
tgcatgttacgcagcggccagatgatgctggcacagggccttctgctgcatttcctgccc
agagactggacatgggccgagggcatgggcctgggcccccctgagctgtcagggtcagcc
tctcccagccggtaccatgggcctgcccgctggatgcccccacgctgggcccagggtgcc
cctgagctggagcaggaacgccggcaccggcagattgtgtcctggttcgccgaccacccc
cgggccccctttggcctacaccggctggtggagcttgggcagagctcaggcaagaaggca
ggtgactggtatgggccatcgctagtggcacacatcctcaggaaagccgtggagagctgc
tccgacgtcacccgcctggtggtgtacgtttctcaggactgcacagtgtacaaggcggat
gtggcacgcctggtggccaggccagaccccacagccgagtggaagtctgtggtcatcctg
gtgcccgtgcgactgggtggcgagactctcaaccccgtgtatgtgccctgcgtgaaggaa
ctcctgcgttgcgagctgtgcctgggcatcatgggtgggaaaccgcgacactcactgtac
ttcattggctaccaagatgacttcctgctgtacctggaccctcactactgccagcccact
gtggatgtcagccaggccgacttccccctggagtccttccactgcacctcgccccgcaag
atggcctttgccaagatggacccaagctgtaccgtgggcttctatgctggagacaggaag
gagtttgagacactctgctcagagctgaccagggtcctcagctcctcctcagccacagag
cggtaccccatgttcaccctggccgagggccatgctcaggaccacagcctggacgacctc
tgctcccagctcgcccagcccacactccggctccctcgcacagggcggctcctcagggcc
aaacgccccagctctgaggactttgtgtttttataa

DBGET integrated database retrieval system