KEGG   Homo sapiens (human): 8499Help
Entry
8499              CDS       T01001                                 

Gene name
PPFIA2
Definition
protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 2
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q21.31
AA seq 1247 aa AA seqDB search
MMCEVMPTINEDTPMSQRGSQSSGSDSDSHFEQLMVNMLDERDRLLDTLRETQESLSLAQ
QRLQDVIYDRDSLQRQLNSALPQDIESLTGGLAGSKGADPPEFAALTKELNACREQLLEK
EEEISELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAQSPSGVSSEVEVLKALKSL
FEHHKALDEKVRERLRVSLERVSALEEELAAANQEIVALREQNVHIQRKMASSEGSTESE
HLEGMEPGQKVHEKRLSNGSIDSTDETSQIVELQELLEKQNYEMAQMKERLAALSSRVGE
VEQEAETARKDLIKTEEMNTKYQRDIREAMAQKEDMEERITTLEKRYLSAQRESTSIHDM
NDKLENELANKEAILRQMEEKNRQLQERLELAEQKLQQTMRKAETLPEVEAELAQRIAAL
TKAEERHGNIEERMRHLEGQLEEKNQELQRARQREKMNEEHNKRLSDTVDRLLTESNERL
QLHLKERMAALEEKNVLIQESETFRKNLEESLHDKERLAEEIEKLRSELDQLKMRTGSLI
EPTIPRTHLDTSAELRYSVGSLVDSQSDYRTTKVIRRPRRGRMGVRRDEPKVKSLGDHEW
NRTQQIGVLSSHPFESDTEMSDIDDDDRETIFSSMDLLSPSGHSDAQTLAMMLQEQLDAI
NKEIRLIQEEKESTELRAEEIENRVASVSLEGLNLARVHPGTSITASVTASSLASSSPPS
GHSTPKLTPRSPAREMDRMGVMTLPSDLRKHRRKIAVVEEDGREDKATIKCETSPPPTPR
ALRMTHTLPSSYHNDARSSLSVSLEPESLGLGSANSSQDSLHKAPKKKGIKSSIGRLFGK
KEKARLGQLRGFMETEAAAQESLGLGKLGTQAEKDRRLKKKHELLEEARRKGLPFAQWDG
PTVVAWLELWLGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQE
MVSLTSPSAPPTSRTPSGNVWVTHEEMENLAAPAKTKESEEGSWAQCPVFLQTLAYGDMN
HEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRTSLQYGIMC
LKRLNYDRKELERRREASQHEIKDVLVWSNDRVIRWIQAIGLREYANNILESGVHGSLIA
LDENFDYSSLALLLQIPTQNTQARQILEREYNNLLALGTERRLDESDDKNFRRGSTWRRQ
FPPREVHGISMMPGSSETLPAGFRLTTTSGQSRKMTTDDGVFSVYST
NT seq 3744 nt NT seq  +upstreamnt  +downstreamnt
atgatgtgtgaagtgatgcccacgattaatgaggacaccccaatgagccaaagggggtcc
caaagcagtggctcggactcagactcccattttgagcagctgatggtgaatatgctagat
gaaagggatcgtcttctagacacccttcgggagacccaggaaagcctctcacttgcccag
caaagacttcaggatgtcatctatgaccgagactcactccagagacagctcaattcagcc
ctgccacaggatatcgaatccctaacaggagggctggctggttctaagggggctgatcca
ccggaatttgctgcactgacaaaagaattaaatgcctgcagggaacaacttctagaaaag
gaagaagaaatctctgaacttaaagctgaaagaaacaacacaagactattactggagcat
ttggagtgccttgtgtcacgacatgaaagatcactaagaatgacggtggtaaaacggcaa
gcccagtctccctcaggagtatccagtgaagttgaagttctcaaggcactgaaatctttg
tttgagcaccacaaggccttggatgaaaaggtaagggagcgactgagggtttctttagaa
agagtctctgcactggaagaagaactagctgctgctaatcaggagattgttgccttgcgt
gaacaaaatgttcatatacaaagaaaaatggcatcaagcgagggatccacagagtcagaa
catcttgaagggatggaacctggacagaaagtccatgagaagcgtttgtccaatggttct
atagactcaaccgatgaaactagtcaaatagttgaactacaagaattgcttgaaaagcaa
aactatgaaatggcccagatgaaagaacgtttagcagccctttcttcccgagtgggagag
gtggaacaggaagcagagacagcaagaaaggatctcattaaaacagaagaaatgaacacc
aagtatcaaagggacattagggaggccatggcacaaaaggaagatatggaagaaagaatt
acaacccttgaaaagcgttacctcagtgctcagagagaatctacctccatacatgacatg
aatgataaactagaaaatgagttagcaaataaagaagctatcctgcggcagatggaagag
aaaaacagacagttacaagaacgtcttgagctagctgaacaaaagttgcagcagaccatg
agaaaggctgaaaccttgcctgaagtagaggctgaactggctcagagaattgcagcccta
accaaggctgaagagagacatggaaatattgaagaacgtatgagacatttagagggtcaa
cttgaagagaagaatcaagaacttcaaagagctaggcaaagagagaaaatgaatgaggag
cataacaagagattatcggatacggttgatagacttctgactgaatccaatgaacgccta
caactacacttaaaggaaagaatggctgctctagaagaaaagaatgttttaattcaagaa
tcagaaactttcagaaagaatcttgaagaatctttacatgataaggaaagattagcagaa
gaaattgaaaagctgagatctgaacttgaccaattgaaaatgagaactggctctttaatt
gaacccacaataccaagaactcatctagacacctcagctgagttgcggtactcagtggga
tccctagtggacagccagtctgattacagaacaactaaagtaataagaagaccaaggaga
ggccgcatgggtgtgcgaagagatgagccaaaggtgaaatctcttggggatcacgagtgg
aatagaactcaacagattggagtactaagcagccacccttttgaaagtgacactgaaatg
tctgatattgatgatgatgacagagaaacaatttttagctcaatggatcttctctctcca
agtggtcattccgatgcccagacgctagccatgatgcttcaggaacaattggatgccatc
aacaaagaaatcaggctaattcaggaagaaaaagaatctacagagttgcgtgctgaagaa
attgaaaatagagtggctagtgtgagcctcgaaggcctgaatttggcaagggtccaccca
ggtacctccattactgcctctgttacagcttcatcgctggccagttcatctccccccagt
ggacactcaactccaaagctcacccctcgaagccctgccagggaaatggatcggatggga
gtcatgacactgccaagtgatctgaggaaacatcggagaaagattgcagttgtggaagaa
gatggtcgagaggacaaagcaacaattaaatgtgaaacttctcctcctcctacccctaga
gccctcagaatgactcacactctcccttcttcctaccacaatgatgctcgaagtagttta
tctgtctctcttgagccagaaagcctcgggcttggtagtgccaacagcagccaagactct
cttcacaaagcccccaagaagaaaggaatcaagtcttcaataggacgtttgtttggtaaa
aaagaaaaagctcgacttgggcagctccgaggctttatggagactgaagctgcagctcag
gagtccctggggttaggcaaactcggaactcaagctgagaaggatcgaagactaaagaaa
aagcatgaacttcttgaagaagctcggagaaagggattaccttttgcccagtgggatggg
ccaactgtggtcgcatggctagagctttggttgggaatgcctgcgtggtacgtggcagcc
tgccgagccaacgtgaagagtggtgccatcatgtctgctttatctgacactgagatccag
agagaaattggaatcagcaatccactgcatcgcttaaaacttcgattagcaatccaggag
atggtttccctaacaagtccttcagctcctccaacatctcgaactccttcaggcaacgtt
tgggtgactcatgaagaaatggaaaatcttgcagctccagcaaaaacgaaagaatctgag
gaaggaagctgggcccagtgtccggtttttctacagaccctggcttatggagatatgaat
catgagtggattggaaatgaatggcttcccagcttggggttacctcagtacagaagttac
tttatggaatgcttggtagatgcaagaatgttagatcacctaacaaaaaaagatctccgt
gtccatttaaaaatggtggatagtttccatcgaacaagtttacaatatggaattatgtgc
ttaaagaggttgaattatgacagaaaagaactagaaagaagacgggaagcaagccaacat
gaaataaaagacgtgttggtgtggagcaatgaccgagttattcgctggatacaagcaatt
ggacttcgagaatatgcaaataatatacttgagagcggtgtgcatggctcacttatagcc
ctggatgaaaactttgactacagcagcttagctttattattacagattccaacacagaac
acccaggcaaggcagattcttgaaagagaatacaataacctcttggccctgggaactgaa
aggcgactggatgaaagtgatgacaagaacttcagacgtggatcaacctggagaaggcag
tttcctcctcgtgaagtacatggaatcagcatgatgcctgggtcctcagaaacattacca
gctggatttaggttaaccacaacctctgggcagtcaagaaaaatgacaacagatgatggc
gtcttttcagtctactctacctaa

DBGET integrated database retrieval system