KEGG   Homo sapiens (human): 84991Help
Entry
84991             CDS       T01001                                 

Gene name
RBM17, SPF45
Definition
(RefSeq) RNA binding motif protein 17
  KO
K12840  splicing factor 45
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    84991 (RBM17)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 related factors
    84991 (RBM17)
 Complex B
    84991 (RBM17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-patch RRM_1
Motif
Other DBs
NCBI-GeneID: 84991
NCBI-ProteinID: NP_001139019
OMIM: 606935
HGNC: 16944
Ensembl: ENSG00000134453
Vega: OTTHUMG00000017618
Pharos: Q96I25(Tbio)
UniProt: Q96I25 Q5W009
Structure
PDB: 

Jmol
Position
10p15.1
AA seq 401 aa AA seqDB search
MSLYDDLGVETSDSKTEGWSKNFKLLQSQLQVKKAALTQAKSQRTKQSTVLAPVIDLKRG
GSSDDRQIVDTPPHVAAGLKDPVPSGFSAGEVLIPLADEYDPMFPNDYEKVVKRQREERQ
RQRELERQKEIEEREKRRKDRHEASGFARRPDPDSDEDEDYERERRKRSMGGAAIAPPTS
LVEKDKELPRDFPYEEDSRPRSQSSKAAIPPPVYEEQDRPRSPTGPSNSFLANMGGTVAH
KIMQKYGFREGQGLGKHEQGLSTALSVEKTSKRGGKIIVGDATEKDASKKSDSNPLTEIL
KCPTKVVLLRNMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEIPGAPDDEAVRIFLEFE
RVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLAEQV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgtacgatgacctaggagtggagaccagtgactcaaaaacagaaggctggtcc
aaaaacttcaaacttctgcagtctcagcttcaggtgaagaaggcagctctcactcaggca
aagagccaaaggacgaaacaaagtacagtcctcgccccagtcattgacctgaagcgaggt
ggctcctcagatgaccggcaaattgtggacactccaccgcatgtagcagctgggctgaag
gatcctgttcccagtgggttttctgcaggggaagttctgattcccttagctgacgaatat
gaccctatgtttcctaatgattatgagaaagtagtgaagcgccaaagagaggaacgacag
agacagcgggagctggaaagacaaaaggaaatagaagaaagggaaaaaaggcgtaaagac
agacatgaagcaagtgggtttgcaaggagaccagatccagattctgatgaagatgaagat
tatgagcgagagaggaggaaaagaagtatgggcggagctgccattgccccacccacttct
ctggtagagaaagacaaagagttaccccgagattttccttatgaagaggactcaagacct
cgatcacagtcttccaaagcagccattcctcccccagtgtacgaggaacaagacagaccg
agatctccaaccggacctagcaactccttcctcgctaacatggggggcacggtggcgcac
aagatcatgcagaagtacggcttccgggagggccagggtctggggaagcatgagcagggc
ctgagcactgccttgtcagtggagaagaccagcaagcgtggcggcaagatcatcgtgggc
gacgccacagagaaagatgcatccaagaagtcagattcaaatccgctgactgaaatactt
aagtgtcctactaaagtggtcttactaaggaacatggttggtgcgggagaggtggatgaa
gacttggaagttgaaaccaaggaagaatgtgaaaaatatggcaaagttggaaaatgtgtg
atatttgaaattcctggtgcccctgatgatgaagcagtacggatatttttagaatttgag
agagttgaatcagcaattaaagcggttgttgacttgaatgggaggtattttggtggacgg
gtggtaaaagcatgtttctacaatttggacaaattcagggtcttggatttggcagaacaa
gtttga

DBGET integrated database retrieval system