KEGG   Homo sapiens (human): 85015Help
Entry
85015             CDS       T01001                                 

Gene name
USP45
Definition
ubiquitin specific peptidase 45 (EC:3.4.19.12)
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     85015 (USP45)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   85015 (USP45)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
6q16.2
AA seq 814 aa AA seqDB search
MRVKDPTKALPEKAKRSKRPTVPHDEDSSDDIAVGLTCQHVSHAISVNHVKRAIAENLWS
VCSECLKERRFYDGQLVLTSDIWLCLKCGFQGCGKNSESQHSLKHFKSSRTEPHCIIINL
STWIIWCYECDEKLSTHCNKKVLAQIVDFLQKHASKTQTSAFSRIMKLCEEKCETDEIQK
GGKCRNLSVRGITNLGNTCFFNAVMQNLAQTYTLTDLMNEIKESSTKLKIFPSSDSQLDP
LVVELSRPGPLTSALFLFLHSMKETEKGPLSPKVLFNQLCQKAPRFKDFQQQDSQELLHY
LLDAVRTEETKRIQASILKAFNNPTTKTADDETRKKVKAYGKEGVKMNFIDRIFIGELTS
TVMCEECANISTVKDPFIDISLPIIEERVSKPLLWGRMNKYRSLRETDHDRYSGNVTIEN
IHQPRAAKKHSSSKDKSQLIHDRKCIRKLSSGETVTYQKNENLEMNGDSLMFASLMNSES
RLNESPTDDSEKEASHSESNVDADSEPSESESASKQTGLFRSSSGSGVQPDGPLYPLSAG
KLLYTKETDSGDKEMAEAISELRLSSTVTGDQDFDRENQPLNISNNLCFLEGKHLRSYSP
QNAFQTLSQSYITTSKECSIQSCLYQFTSMELLMGNNKLLCENCTKNKQKYQEETSFAEK
KVEGVYTNARKQLLISAVPAVLILHLKRFHQAGLSLRKVNRHVDFPLMLDLAPFCSATCK
NASVGDKVLYGLYGIVEHSGSMREGHYTAYVKVRTPSRKLSEHNTKKKNVPGLKAADNES
AGQWVHVSDTYLQVVPESRALSAQAYLLFYERVL
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtgaaagatccaactaaagctttacctgagaaagccaaaagaagtaaaaggcct
actgtacctcatgatgaagactcttcagatgatattgctgtaggtttaacttgccaacat
gtaagtcatgctatcagcgtgaatcatgtaaagagagcaatagctgagaatctgtggtca
gtttgctcagaatgtttaaaagaaagaagattctatgatgggcagctagtacttacttct
gatatttggttgtgcctcaagtgtggcttccagggatgtggtaaaaactcagaaagccaa
cattcattgaagcactttaagagttccagaacagagccccattgtattataattaatctg
agcacatggattatatggtgttatgaatgtgatgaaaaattatcaacgcattgtaataag
aaggttttggctcagatagttgattttctccagaaacatgcttctaaaacacaaacaagt
gcattttctagaatcatgaaactttgtgaagaaaaatgtgaaacagatgaaatacagaag
ggaggaaaatgcagaaatttatctgtaagaggaattacaaatttaggaaatacttgcttt
tttaatgcagtcatgcagaacttggcacagacttatactcttactgatctgatgaatgag
atcaaagaaagtagtacaaaactcaagatttttccttcctcagactctcagctggaccca
ttggtggtggaactttcaaggcctggaccactgacctcagccttgttcctgtttcttcac
agcatgaaggagactgaaaaaggaccactttctcctaaagttctttttaatcagctttgt
cagaaggcacctcgatttaaagatttccagcaacaggacagtcaggagcttcttcattat
cttctggatgcagtgaggacagaagaaacaaagcgaatacaagctagcattctaaaagca
tttaacaacccaactactaaaactgctgatgatgaaactagaaaaaaagtcaaagcatat
ggaaaagaaggtgtgaaaatgaacttcatagatcggatctttattggtgaattaactagc
acggtcatgtgtgaagaatgtgcaaatatctccacggtgaaagatccattcattgatatt
tcacttcctataatagaagaaagggtttcaaaacctttactttggggaagaatgaataaa
tatagaagtttacgggagacagatcatgatcgatacagtggcaatgttactatagaaaat
attcatcaacctagagctgccaagaagcattcttcatctaaagataagagtcaactaatt
catgaccgaaaatgtattagaaaattgtcatctggagaaactgtcacataccagaaaaat
gaaaaccttgaaatgaatggggattctttaatgtttgccagcctcatgaattctgagtca
cgtctgaatgaaagccctactgatgacagtgaaaaagaagccagccattctgaaagcaat
gttgatgctgacagtgagccttcagaatctgaaagtgcttcaaagcagactgggctgttc
agatccagtagtggatccggtgtgcagccagatggacccctttaccctctgtcagcaggt
aaactgctgtacaccaaggagactgacagtggtgataaggaaatggcagaagctatttct
gaacttcgtttgagcagcactgtaactggagatcaagattttgacagagaaaatcagcca
ctaaatatttcaaataatttatgttttttagaggggaagcatttgaggtcttatagtccc
caaaatgcttttcagaccctttctcagagctatataactacttctaaagaatgttcaatt
cagtcctgtctctaccagtttacatctatggaattactaatggggaataataagcttcta
tgtgagaattgtactaaaaacaaacagaagtaccaagaagaaaccagttttgcagaaaag
aaagtagaaggagtttatactaatgccaggaagcaattgctcatttctgctgttccagct
gtcctaattctccacctgaaaagatttcatcaggctggcttgagtcttcgtaaagtaaac
agacatgtagattttccacttatgctcgatttagcaccattctgctctgctacttgtaag
aatgcaagtgtgggagataaagttctctacggtctctatggcatagtggaacatagtggc
tcgatgagagaaggccactacactgcttatgtgaaagtgagaacaccctccaggaaatta
tcggaacataacactaaaaagaaaaatgtgcctggtttgaaagcggctgataatgaatca
gcaggccagtgggtccatgttagtgacacttacttacaggtggttccagaatcaagagca
cttagtgcacaagcctaccttcttttctatgaaagagtattataa

DBGET integrated database retrieval system