KEGG   Homo sapiens (human): 8513Help
Entry
8513              CDS       T01001                                 

Gene name
LIPF, GL, HGL, HLAL
Definition
lipase, gastric (EC:3.1.1.3)
Orthology
K14452  
gastric triacylglycerol lipase [EC:3.1.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Metabolic pathways
Fat digestion and absorption
Module
Acylglycerol degradation
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:hsa00561]
Organismal Systems; Digestive system; Fat digestion and absorption [PATH:hsa04975]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q23.31
AA seq 365 aa AA seqDB search
MWLLLTMASLISVLGTTHGLFGKLHPGSPEVTMNISQMITYWGYPNEEYEVVTEDGYILE
VNRIPYGKKNSGNTDAGYDVWLGNSRGNTWARRNLYYSPDSVEFWAFSFDEMAKYDLPAT
IDFIVKKTGQKQLHYVGHSQGTTIGFIAFSTNPSLAKRIKTFYALAPVATVKYTKSLINK
LRFVPQSLFKFIFGDKIFYPHNFFDQFLATEVCSREMLNLLCSNALFIICGFDSKNFNTS
RLDVYLSHNPAGTSVQNMFHWTQAVKSGKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNV
PIAVWNGGKDLLADPQDVGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMI
SEDKK
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgcttttaacaatggcaagtttgatatctgtactggggactacacatggtttg
tttggaaaattacatcctggaagccctgaagtgactatgaacattagtcagatgattact
tattggggatacccaaatgaagaatatgaagttgtgactgaagatggttatattcttgaa
gtcaatagaattccttatgggaagaaaaattcagggaatacagatgctggttatgatgtg
tggctgggcaacagcagaggaaacacctgggccagaagaaacttgtactattcaccagat
tcagttgaattctgggctttcagctttgatgaaatggctaaatatgaccttccagccaca
atcgacttcattgtaaagaaaactggacagaagcagctacactatgttggccattcccag
ggcaccaccattggttttattgccttttccaccaatcccagcctggctaaaagaatcaaa
accttctatgctctagctcctgttgccactgtgaagtatacaaaaagccttataaacaaa
cttagatttgttcctcaatccctcttcaagtttatatttggtgacaaaatattctaccca
cacaacttctttgatcaatttcttgctactgaagtgtgctcccgtgagatgctgaatctc
ctttgcagcaatgccttatttataatttgtggatttgacagtaagaactttaacacgagt
cgcttggatgtgtatctatcacataatccagcaggaacttctgttcaaaacatgttccat
tggacccaggctgttaagtctgggaaattccaagcttatgactggggaagcccagttcag
aataggatgcactatgatcagtcccaacctccctactacaatgtgacagccatgaatgta
ccaattgcagtgtggaacggtggcaaggacctgttggctgacccccaagatgttggcctt
ttgcttccaaaactccccaatcttatttaccacaaggagattcctttttacaatcacttg
gactttatctgggcaatggatgcccctcaagaagtttacaatgacattgtttctatgata
tcagaagataaaaagtag

DBGET integrated database retrieval system