KEGG   Homo sapiens (human): 8513Help
Entry
8513              CDS       T01001                                 

Gene name
LIPF, GL, HGL, HLAL
Definition
lipase, gastric (EC:3.1.1.3)
Orthology
K14452  
gastric triacylglycerol lipase [EC:3.1.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Metabolic pathways
Fat digestion and absorption
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    8513 (LIPF)
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    8513 (LIPF)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     8513 (LIPF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q23.31
AA seq 365 aa AA seqDB search
MWLLLTMASLISVLGTTHGLFGKLHPGSPEVTMNISQMITYWGYPNEEYEVVTEDGYILE
VNRIPYGKKNSGNTDAGYDVWLGNSRGNTWARRNLYYSPDSVEFWAFSFDEMAKYDLPAT
IDFIVKKTGQKQLHYVGHSQGTTIGFIAFSTNPSLAKRIKTFYALAPVATVKYTKSLINK
LRFVPQSLFKFIFGDKIFYPHNFFDQFLATEVCSREMLNLLCSNALFIICGFDSKNFNTS
RLDVYLSHNPAGTSVQNMFHWTQAVKSGKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNV
PIAVWNGGKDLLADPQDVGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMI
SEDKK
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgcttttaacaatggcaagtttgatatctgtactggggactacacatggtttg
tttggaaaattacatcctggaagccctgaagtgactatgaacattagtcagatgattact
tattggggatacccaaatgaagaatatgaagttgtgactgaagatggttatattcttgaa
gtcaatagaattccttatgggaagaaaaattcagggaatacagatgctggttatgatgtg
tggctgggcaacagcagaggaaacacctgggccagaagaaacttgtactattcaccagat
tcagttgaattctgggctttcagctttgatgaaatggctaaatatgaccttccagccaca
atcgacttcattgtaaagaaaactggacagaagcagctacactatgttggccattcccag
ggcaccaccattggttttattgccttttccaccaatcccagcctggctaaaagaatcaaa
accttctatgctctagctcctgttgccactgtgaagtatacaaaaagccttataaacaaa
cttagatttgttcctcaatccctcttcaagtttatatttggtgacaaaatattctaccca
cacaacttctttgatcaatttcttgctactgaagtgtgctcccgtgagatgctgaatctc
ctttgcagcaatgccttatttataatttgtggatttgacagtaagaactttaacacgagt
cgcttggatgtgtatctatcacataatccagcaggaacttctgttcaaaacatgttccat
tggacccaggctgttaagtctgggaaattccaagcttatgactggggaagcccagttcag
aataggatgcactatgatcagtcccaacctccctactacaatgtgacagccatgaatgta
ccaattgcagtgtggaacggtggcaaggacctgttggctgacccccaagatgttggcctt
ttgcttccaaaactccccaatcttatttaccacaaggagattcctttttacaatcacttg
gactttatctgggcaatggatgcccctcaagaagtttacaatgacattgtttctatgata
tcagaagataaaaagtag

DBGET integrated database retrieval system