KEGG   Homo sapiens (human): 8515Help
Entry
8515              CDS       T01001                                 

Gene name
ITGA10, PRO827
Definition
integrin, alpha 10
Orthology
K06586  
integrin alpha 10
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Regulation of actin cytoskeleton
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    8515 (ITGA10)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    8515 (ITGA10)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    8515 (ITGA10)
  Cell communication
   04510 Focal adhesion
    8515 (ITGA10)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    8515 (ITGA10)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    8515 (ITGA10)
   05414 Dilated cardiomyopathy (DCM)
    8515 (ITGA10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q21
AA seq 1167 aa AA seqDB search
MELPFVTHLFLPLVFLTGLCSPFNLDEHHPRLFPGPPEAEFGYSVLQHVGGGQRWMLVGA
PWDGPSGDRRGDVYRCPVGGAHNAPCAKGHLGDYQLGNSSHPAVNMHLGMSLLETDGDGG
FMACAPLWSRACGSSVFSSGICARVDASFQPQGSLAPTAQRCPTYMDVVIVLDGSNSIYP
WSEVQTFLRRLVGKLFIDPEQIQVGLVQYGESPVHEWSLGDFRTKEEVVRAAKNLSRREG
RETKTAQAIMVACTEGFSQSHGGRPEAARLLVVVTDGESHDGEELPAALKACEAGRVTRY
GIAVLGHYLRRQRDPSSFLREIRTIASDPDERFFFNVTDEAALTDIVDALGDRIFGLEGS
HAENESSFGLEMSQIGFSTHRLKDGILFGMVGAYDWGGSVLWLEGGHRLFPPRMALEDEF
PPALQNHAAYLGYSVSSMLLRGGRRLFLSGAPRFRHRGKVIAFQLKKDGAVRVAQSLQGE
QIGSYFGSELCPLDTDRDGTTDVLLVAAPMFLGPQNKETGRVYVYLVGQQSLLTLQGTLQ
PEPPQDARFGFAMGALPDLNQDGFADVAVGAPLEDGHQGALYLYHGTQSGVRPHPAQRIA
AASMPHALSYFGRSVDGRLDLDGDDLVDVAVGAQGAAILLSSRPIVHLTPSLEVTPQAIS
VVQRDCRRRGQEAVCLTAALCFQVTSRTPGRWDHQFYMRFTASLDEWTAGARAAFDGSGQ
RLSPRRLRLSVGNVTCEQLHFHVLDTSDYLRPVALTVTFALDNTTKPGPVLNEGSPTSIQ
KLVPFSKDCGPDNECVTDLVLQVNMDIRGSRKAPFVVRGGRRKVLVSTTLENRKENAYNT
SLSLIFSRNLHLASLTPQRESPIKVECAAPSAHARLCSVGHPVFQTGAKVTFLLEFEFSC
SSLLSQVFVKLTASSDSLERNGTLQDNTAQTSAYIQYEPHLLFSSESTLHRYEVHPYGTL
PVGPGPEFKTTLRVQNLGCYVVSGLIISALLPAVAHGGNYFLSLSQVITNNASCIVQNLT
EPPGPPVHPEELQHTNRLNGSNTQCQVVRCHLGQLAKGTEVSVGLLRLVHNEFFRRAKFK
SLTVVSTFELGTEEGSVLQLTEASRWSESLLEVVQTRPILISLWILIGSVLGGLLLLALL
VFCLWKLGFFAHKKIPEEEKREEKLEQ
NT seq 3504 nt NT seq  +upstreamnt  +downstreamnt
atggaactccccttcgtcactcacctgttcttgcccctggtgttcctgacaggtctctgc
tccccctttaacctggatgaacatcacccacgcctattcccagggccaccagaagctgaa
tttggatacagtgtcttacaacatgttgggggtggacagcgatggatgctggtgggcgcc
ccctgggatgggccttcaggcgaccggaggggggacgtttatcgctgccctgtagggggg
gcccacaatgccccatgtgccaagggccacttaggtgactaccaactgggaaattcatct
catcctgctgtgaatatgcacctggggatgtctctgttagagacagatggtgatggggga
ttcatggcctgtgcccctctctggtctcgtgcttgtggcagctctgtcttcagttctggg
atatgtgcccgtgtggatgcttcattccagcctcagggaagcctggcacccactgcccaa
cgctgcccaacatacatggatgttgtcattgtcttggatggctccaacagcatctacccc
tggtctgaagttcagaccttcctacgaagactggtagggaaactgtttattgacccagaa
cagatacaggtgggactggtacagtatggggagagccctgtacatgagtggtccctggga
gatttccgaacgaaggaagaagtggtgagagcagcaaagaacctcagtcggcgggaggga
cgagaaacaaagactgcccaagcaataatggtggcctgcacagaagggttcagtcagtcc
catgggggccgacccgaggctgccaggctactggtggttgtcactgatggagagtcccat
gatggagaggagcttcctgcagcactaaaggcctgtgaggctggaagagtgacacgctat
gggattgcagtccttggtcactacctccggcggcagcgagatcccagctctttcctgaga
gaaattagaactattgccagtgatccagatgagcgattcttcttcaatgtcacagatgag
gctgctctgactgacattgtggatgcactaggagatcggatttttggccttgaagggtcc
catgcagaaaacgaaagctcctttgggctggaaatgtctcagattggtttctccactcat
cggctaaaggatgggattctttttgggatggtgggggcctatgactggggaggctctgtg
ctatggcttgaaggaggccaccgccttttccccccacgaatggcactggaagacgagttc
ccccctgcactgcagaaccatgcagcctacctgggttactctgtttcttccatgcttttg
cggggtggacgccgcctgtttctctctggggctcctcgatttagacatcgaggaaaagtc
atcgccttccagcttaagaaagatggggctgtgagggttgcccagagcctccagggggag
cagattggttcatactttggcagtgagctctgcccattggatacagatagggatggaaca
actgatgtcttacttgtggctgcccccatgttcctgggaccccagaacaaggaaacagga
cgtgtttatgtgtatctggtaggccagcagtccttgctgaccctccaaggaacacttcag
ccagaacccccccaggatgctcggtttggctttgccatgggagctcttcctgatctgaac
caagatggttttgctgatgtggctgtgggggcgcctctggaagatgggcaccagggagca
ctgtacctgtaccatggaacccagagtggagtcaggccccatcctgcccagaggattgct
gctgcctccatgccacatgccctcagctactttggccgaagtgtggatggtcggctagat
ctggatggagatgatctggtcgatgtggctgtgggtgcccagggggcagccatcctgctc
agctcccggcccattgtccatctgaccccatcactggaggtgaccccacaggccatcagt
gtggttcagagggactgtaggcggcgaggccaagaggcagtctgtctgactgcagccctt
tgcttccaagtgacctcccgtactcctggtcgctgggatcaccaattctacatgaggttc
accgcatcactggatgaatggactgctggggcacgtgcagcatttgatggctctggccag
aggttgtcccctcggaggctccggctcagtgtggggaatgtcacttgtgagcagctacac
ttccatgtgctggatacatcagattacctccggccagtggccttgactgtgacctttgcc
ttggacaatactacaaagccagggcctgtgctgaatgagggctcacccacctctatacaa
aagctggtccccttctcaaaggattgtggccctgacaatgaatgtgtcacagacctggtg
cttcaagtgaatatggacatcagaggctccaggaaggccccatttgtggttcgaggtggc
cggcggaaagtgctggtatctacaactctggagaacagaaaggaaaatgcttacaatacg
agcctgagtctcatcttctctagaaacctccacctggccagtctcactcctcagagagag
agcccaataaaggtggaatgtgccgccccttctgctcatgcccggctctgcagtgtgggg
catcctgtcttccagactggagccaaggtgacctttctgctagagtttgagtttagctgc
tcctctctcctgagccaggtcttcgtgaagctgactgccagcagtgacagcctggagaga
aatgggacccttcaagataacacagcccagacctcagcctacatccaatatgagccccac
ctcctgttctctagtgagtctaccctgcaccgctatgaggttcacccatatgggaccctc
ccagtgggtcctggcccagaattcaaaaccactctcagggttcagaacctaggctgctat
gtggtcagtggcctcatcatctcagccctccttccagctgtggcccatgggggcaattac
ttcctatcactgtctcaagtcatcactaacaatgcaagctgcatagtgcagaacctgact
gaacccccaggcccacctgtgcatccagaggagcttcaacacacaaacagactgaatggg
agcaatactcagtgtcaggtggtgaggtgccaccttgggcagctggcaaaggggactgag
gtctctgttggactattgaggctggttcacaatgaatttttccgaagagccaagttcaag
tccctgacggtggtcagcacctttgagctgggaaccgaagagggcagtgtcctacagctg
actgaagcctcccgttggagtgagagcctcttggaggtggttcagacccggcctatcctc
atctccctgtggatcctcataggcagtgtcctgggagggttgctcctgcttgctctcctt
gtcttctgcctgtggaagcttggcttctttgcccataagaaaatccctgaggaagaaaaa
agagaagagaagttggagcaatga

DBGET integrated database retrieval system