KEGG   Homo sapiens (human): 8520Help
Entry
8520              CDS       T01001                                 

Gene name
HAT1, KAT1
Definition
histone acetyltransferase 1 (EC:2.3.1.48)
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Substance dependence
   05034 Alcoholism
    8520 (HAT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     8520 (HAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q31.2-q33.1
AA seq 419 aa AA seqDB search
MAGFGAMEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLF
GDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFC
TNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQT
FLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQ
MLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCF
SREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLI
SPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcgggatttggtgctatggagaaatttttggtagaatataagagtgcagtggagaag
aaactggcagagtacaaatgtaacaccaacacagcaattgaactaaaattagttcgtttt
cctgaagatcttgaaaatgacattagaactttctttcctgagtatacccatcaactcttt
ggggatgatgaaactgcttttggttacaagggtctaaagatcctgttatactatattgct
ggtagcctgtcaacaatgttccgtgttgaatatgcatctaaagttgatgagaactttgac
tgtgtagaggcagatgatgttgagggcaaaattagacaaatcattccacctggattttgc
acaaacacgaatgatttcctttctttactggaaaaggaagttgatttcaagccattcgga
accttacttcatacctactcagttctcagtccaacaggaggagaaaactttacctttcag
atatataaggctgacatgacatgtagaggctttcgagaatatcatgaaaggcttcagacc
tttttgatgtggtttattgaaactgctagctttattgacgtggatgatgaaagatggcac
tactttctagtatttgagaagtataataaggatggagctacgctctttgcgaccgtaggc
tacatgacagtctataattactatgtgtacccagacaaaacccggccacgtgtaagtcag
atgctgattttgactccatttcaaggtcaaggccatggtgctcaacttcttgaaacagtt
catagatactacactgaatttcctacagttcttgatattacagcggaagatccatccaaa
agctatgtgaaattacgagactttgtgcttgtgaagctttgtcaagatttgccctgtttt
tcccgggaaaaattaatgcaaggattcaatgaagatatggcgatagaggcacaacagaag
ttcaaaataaataagcaacacgctagaagggtttatgaaattcttcgactactggtaact
gacatgagtgatgccgaacaatacagaagctacagactggatattaaaagaagactaatt
agcccatataagaaaaagcagagagatcttgctaagatgagaaaatgtctcagaccagaa
gaactgacaaaccagatgaaccaaatagaaataagcatgcaacatgaacagctggaagag
agttttcaggaactagtggaagattaccggcgtgttattgaacgacttgctcaagagtaa

DBGET integrated database retrieval system