KEGG   Homo sapiens (human): 8529Help
Entry
8529              CDS       T01001                                 

Gene name
CYP4F2, CPF2
Definition
cytochrome P450, family 4, subfamily F, polypeptide 2 (EC:1.14.13.30)
Orthology
K17726  
leukotriene-B4 20-monooxygenase [EC:1.14.13.30]
Organism
hsa  Homo sapiens (human)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    8529 (CYP4F2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.30  leukotriene-B4 20-monooxygenase
     8529 (CYP4F2)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP4 family
   8529 (CYP4F2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.12
AA seq 520 aa AA seqDB search
MSQLSLSWLGLWPVAASPWLLLLLVGASWLLAHVLAWTYAFYDNCRRLRCFPQPPRRNWF
WGHQGMVNPTEEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPDIIRSVINASAAIAPK
DKFFYSFLEPWLGDGLLLSAGDKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQL
LASEGSACLDMFEHISLMTLDSLQKCVFSFDSHCQEKPSEYIAAILELSALVSKRHHEIL
LHIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFID
VLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQE
LLKDREPKEIEWDDLAHLPFLTMCMKESLRLHPPVPVISRHVTQDIVLPDGRVIPKGIIC
LISVFGTHHNPAVWPDPEVYDPFRFDPENIKERSPLAFIPFSAGPRNCIGQTFAMAEMKV
VLALTLLRFRVLPDHTEPRRKPELVLRAEGGLWLRVEPLS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagctgagcctgtcctggctgggcctctggccagtggcagcatccccttggctg
ctcctcctgctggtcggggcctcctggctcctggcccatgtcctggcctggacctacgcc
ttctatgacaactgccgccgccttcggtgtttcccacaacccccaagacggaactggttt
tggggacaccagggcatggtcaaccccacagaggagggcatgagagttctgactcagctg
gtggccacctacccccagggctttaaggtctggatgggacccatctcccccctcctcagt
ttgtgccaccccgacatcatccggtctgtcatcaacgcctcagctgccattgcaccaaag
gacaagttcttctacagcttcctggagccctggctgggggatgggctcctgctgagtgct
ggtgacaagtggagccgccaccgtcggatgctgacgcctgccttccatttcaacatcctg
aagccctatatgaagattttcaatgagagtgtgaacatcatgcacgccaagtggcagctc
ctggcctcagagggtagtgcctgtttggatatgtttgagcacatcagcctcatgaccttg
gacagtctacagaaatgtgtcttcagctttgacagccattgtcaggagaaacccagtgaa
tatattgccgccatcttggagctcagtgcccttgtatcaaaaagacaccatgagatcctc
ctgcatattgacttcctgtattatctcacccctgatgggcagcgtttccgcagggcctgc
cgcctggtgcacgacttcacagatgccgtcatccaggagcggcgccgcactctccctagc
cagggtgttgatgacttcctccaagccaaggccaaatccaagactttggacttcattgat
gtactcctgctgagcaaggatgaagacgggaagaagttatctgatgaggacataagagca
gaagctgacacctttatgtttgagggccatgacaccacggccagtggtctctcctgggtc
ctgtaccaccttgcaaagcacccagaataccaggagcgctgccggcaggaggtgcaagaa
cttctgaaggaccgtgagcctaaagagattgaatgggacgacctggcccatttgcccttc
ctgaccatgtgcatgaaggagagcctgcggctgcatcccccagtcccggtcatctcccgc
catgtcacccaggacattgtgctcccagacggccgggtcatccccaaaggcattatctgc
ctcatcagtgttttcggaacccatcacaacccagctgtgtggccggaccctgaggtctac
gacccctttcgctttgacccagagaacatcaaggagaggtcacctctggcttttattccc
ttctcggcagggcccaggaactgcatcgggcagacgttcgcgatggcggagatgaaggtg
gtcctggcgctcacgctgctgcgcttccgcgtcctgcctgaccacaccgagccccgcagg
aagccggagctggtcctgcgcgcagagggcggactttggctgcgggtggagcccctgagc
tga

DBGET integrated database retrieval system