KEGG   Homo sapiens (human): 8529Help
Entry
8529              CDS       T01001                                 

Gene name
CYP4F2, CPF2
Definition
cytochrome P450, family 4, subfamily F, polypeptide 2 (EC:1.14.13.30)
Orthology
K17726  
leukotriene-B4 20-monooxygenase [EC:1.14.13.30]
Organism
hsa  Homo sapiens (human)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:hsa00590]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.12
AA seq 520 aa AA seqDB search
MSQLSLSWLGLWPVAASPWLLLLLVGASWLLAHVLAWTYAFYDNCRRLRCFPQPPRRNWF
WGHQGMVNPTEEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPDIIRSVINASAAIAPK
DKFFYSFLEPWLGDGLLLSAGDKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQL
LASEGSACLDMFEHISLMTLDSLQKCVFSFDSHCQEKPSEYIAAILELSALVSKRHHEIL
LHIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFID
VLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQE
LLKDREPKEIEWDDLAHLPFLTMCMKESLRLHPPVPVISRHVTQDIVLPDGRVIPKGIIC
LISVFGTHHNPAVWPDPEVYDPFRFDPENIKERSPLAFIPFSAGPRNCIGQTFAMAEMKV
VLALTLLRFRVLPDHTEPRRKPELVLRAEGGLWLRVEPLS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagctgagcctgtcctggctgggcctctggccagtggcagcatccccttggctg
ctcctcctgctggtcggggcctcctggctcctggcccatgtcctggcctggacctacgcc
ttctatgacaactgccgccgccttcggtgtttcccacaacccccaagacggaactggttt
tggggacaccagggcatggtcaaccccacagaggagggcatgagagttctgactcagctg
gtggccacctacccccagggctttaaggtctggatgggacccatctcccccctcctcagt
ttgtgccaccccgacatcatccggtctgtcatcaacgcctcagctgccattgcaccaaag
gacaagttcttctacagcttcctggagccctggctgggggatgggctcctgctgagtgct
ggtgacaagtggagccgccaccgtcggatgctgacgcctgccttccatttcaacatcctg
aagccctatatgaagattttcaatgagagtgtgaacatcatgcacgccaagtggcagctc
ctggcctcagagggtagtgcctgtttggatatgtttgagcacatcagcctcatgaccttg
gacagtctacagaaatgtgtcttcagctttgacagccattgtcaggagaaacccagtgaa
tatattgccgccatcttggagctcagtgcccttgtatcaaaaagacaccatgagatcctc
ctgcatattgacttcctgtattatctcacccctgatgggcagcgtttccgcagggcctgc
cgcctggtgcacgacttcacagatgccgtcatccaggagcggcgccgcactctccctagc
cagggtgttgatgacttcctccaagccaaggccaaatccaagactttggacttcattgat
gtactcctgctgagcaaggatgaagacgggaagaagttatctgatgaggacataagagca
gaagctgacacctttatgtttgagggccatgacaccacggccagtggtctctcctgggtc
ctgtaccaccttgcaaagcacccagaataccaggagcgctgccggcaggaggtgcaagaa
cttctgaaggaccgtgagcctaaagagattgaatgggacgacctggcccatttgcccttc
ctgaccatgtgcatgaaggagagcctgcggctgcatcccccagtcccggtcatctcccgc
catgtcacccaggacattgtgctcccagacggccgggtcatccccaaaggcattatctgc
ctcatcagtgttttcggaacccatcacaacccagctgtgtggccggaccctgaggtctac
gacccctttcgctttgacccagagaacatcaaggagaggtcacctctggcttttattccc
ttctcggcagggcccaggaactgcatcgggcagacgttcgcgatggcggagatgaaggtg
gtcctggcgctcacgctgctgcgcttccgcgtcctgcctgaccacaccgagccccgcagg
aagccggagctggtcctgcgcgcagagggcggactttggctgcgggtggagcccctgagc
tga

DBGET integrated database retrieval system