KEGG   Homo sapiens (human): 8531Help
Entry
8531              CDS       T01001                                 

Gene name
YBX3, CSDA, CSDA1, DBPA, ZONAB
Definition
Y box binding protein 3
Orthology
K06099  
cold shock domain protein A
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Class
Cellular Processes; Cell communication; Tight junction [PATH:hsa04530]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12p13.1
AA seq 303 aa AA seqDB search
MSEAGEATTTTTTTLPQAPTEAAAAAPQDPAPKSPVGSGAPQAAAPAPAAHVAGNPGGDA
APAATGTAAAASLATAAGSEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQ
TAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRRRYRRG
YYGRRRGPPRNAGEIGEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPRPAPAVGEAE
DKENQQATSGPNQPSVRRGYRRPYNYRRRPRPPNAPSQDGKEAKAGEAPTENPAPPTQQS
SAE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaggcgggcgaggccaccaccaccaccaccaccaccctcccgcaggctccgacg
gaggcggccgccgcggctccccaggaccccgcgcccaagagcccggtgggcagcggtgcg
ccccaggccgcggccccggcgcccgccgcccacgtcgcaggaaaccccggtggggacgcg
gcccccgcagccacgggcaccgcggccgccgcctctttagccaccgccgccggcagcgaa
gacgcggagaaaaaagttctcgccaccaaagtccttggcactgtcaaatggttcaacgtc
agaaatggatatggatttataaatcgaaatgacaccaaagaagatgtatttgtacatcag
actgccatcaagaagaataacccacggaaatatctgcgcagtgtaggagatggagaaact
gtagagtttgatgtggttgaaggagagaagggtgcagaagctgccaatgtgactggcccg
gatggagttcctgtggaagggagtcgttacgctgcagatcggcgccgttacagacgtggc
tactatggaaggcgccgtggccctccccggaatgctggtgagattggagagatgaaggat
ggagtcccagagggagcacaacttcagggaccggttcatcgaaatccaacttaccgccca
aggtaccgtagcaggggacctcctcgcccacgacctgccccagcagttggagaggctgaa
gataaagaaaatcagcaagccaccagtggtccaaaccagccgtctgttcgccgtggatac
cggcgtccctacaattaccggcgtcgcccgcgtcctcctaacgctccttcacaagatggc
aaagaggccaaggcaggtgaagcaccaactgagaaccctgctccacccacccagcagagc
agtgctgagtaa

DBGET integrated database retrieval system