KEGG   Homo sapiens (human): 85366Help
Entry
85366             CDS       T01001                                 

Gene name
MYLK2, KMLC, MLCK, MLCK2, skMLCK
Definition
myosin light chain kinase 2 (EC:2.7.11.18)
Orthology
K00907  
myosin-light-chain kinase [EC:2.7.11.18]
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Focal adhesion
Platelet activation
Regulation of actin cytoskeleton
Oxytocin signaling pathway
Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    85366 (MYLK2)
   04022 cGMP - PKG signaling pathway
    85366 (MYLK2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    85366 (MYLK2)
  Cell communication
   04510 Focal adhesion
    85366 (MYLK2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    85366 (MYLK2)
  Endocrine system
   04921 Oxytocin signaling pathway
    85366 (MYLK2)
  Circulatory system
   04270 Vascular smooth muscle contraction
    85366 (MYLK2)
  Digestive system
   04971 Gastric acid secretion
    85366 (MYLK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     85366 (MYLK2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  MLCK family
   85366 (MYLK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q13.31
AA seq 596 aa AA seqDB search
MATENGAVELGIQNPSTDKAPKGPTGERPLAAGKDPGPPDPKKAPDPPTLKKDAKAPASE
KGDGTLAQPSTSSQGPKGEGDRGGGPAEGSAGPPAALPQQTATPETSVKKPKAEQGASGS
QDPGKPRVGKKAAEGQAAARRGSPAFLHSPSCPAIISSSEKLLAKKPPSEASELTFEGVP
MTHSPTDPRPAKAEEGKNILAESQKEVGEKTPGQAGQAKMQGDTSRGIEFQAVPSEKSEV
GQALCLTAREEDCFQILDDCPPPPAPFPHRMVELRTGNVSSEFSMNSKEALGGGKFGAVC
TCMEKATGLKLAAKVIKKQTPKDKEMVLLEIEVMNQLNHRNLIQLYAAIETPHEIVLFME
YIEGGELFERIVDEDYHLTEVDTMVFVRQICDGILFMHKMRVLHLDLKPENILCVNTTGH
LVKIIDFGLARRYNPNEKLKVNFGTPEFLSPEVVNYDQISDKTDMWSMGVITYMLLSGLS
PFLGDDDTETLNNVLSGNWYFDEETFEAVSDEAKDFVSNLIVKDQRARMNAAQCLAHPWL
NNLAEKAKRCNRRLKSQILLKKYLMKRRWKKNFIAVSAANRFKKISSSGALMALGV
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagaaaatggagcagttgagctgggaattcagaacccatcaacagacaaggca
cctaaaggtcccacaggtgaaagacccctggctgcagggaaagaccctggccccccagac
ccaaagaaagctccggatccacccaccctgaagaaagatgccaaagcccctgcctcagag
aaaggggatggtaccctggcccaaccctcaactagcagccaaggccccaaaggagagggt
gacaggggcggggggcccgcggagggcagtgctgggcccccggcagccctgccccagcag
actgcgacacctgagaccagcgtcaagaagcccaaggctgagcagggagcctcaggcagc
caggatcctggaaagcccagggtgggcaagaaggcagcagagggccaagcagcagccagg
aggggctcacctgcctttctgcatagccccagctgtcctgccatcatctccagttctgag
aagctgctggccaagaagcccccaagcgaggcatcagagctcacctttgaaggggtgccc
atgacccacagccccacggatcccaggccagccaaggcagaagaaggaaagaacatcctg
gcagagagccagaaggaagtgggagagaaaaccccaggccaggctggccaggctaagatg
caaggggacacctcgagggggattgagttccaggctgttccctcagagaaatccgaggtg
gggcaggccctctgtctcacagccagggaggaggactgcttccagattttggatgattgc
ccgccacctccggcccccttccctcaccgcatggtggagctgaggaccgggaatgtcagc
agtgaattcagtatgaactccaaggaggcgctcggaggtggcaagtttggggcagtctgt
acctgcatggagaaagccacaggcctcaagctggcagccaaggtcatcaagaaacagact
cccaaagacaaggaaatggtgttgctggagattgaggtcatgaaccagctgaaccaccgc
aatctgatccagctgtatgcagccatcgagactccgcatgagatcgtcctgttcatggag
tacatcgagggcggagagctcttcgagaggattgtggatgaggactaccatctgaccgag
gtggacaccatggtgtttgtcaggcagatctgtgacgggatcctcttcatgcacaagatg
agggttttgcacctggacctcaagccagagaacatcctgtgtgtcaacaccaccgggcat
ttggtgaagatcattgactttggcctggcacggaggtataaccccaacgagaagctgaag
gtgaactttgggaccccagagttcctgtcacctgaggtggtgaattatgaccaaatctcc
gataagacagacatgtggagtatgggggtgatcacctacatgctgctgagcggcctctcc
cccttcctgggagatgatgacacagagaccctaaacaacgttctatctggcaactggtac
tttgatgaagagacctttgaggccgtatcagacgaggccaaagactttgtctccaacctc
atcgtcaaggaccagagggcccggatgaacgctgcccagtgtctcgcccatccctggctc
aacaacctggcggagaaagccaaacgctgtaaccgacgccttaagtcccagatcttgctt
aagaaatacctcatgaagaggcgctggaagaaaaacttcattgctgtcagcgctgccaac
cgcttcaagaagatcagcagctcgggggcactgatggctctgggggtctga

DBGET integrated database retrieval system