KEGG   Homo sapiens (human): 85414Help
Entry
85414             CDS       T01001                                 

Gene name
SLC45A3, IPCA-2, IPCA-6, IPCA-8, IPCA6, PCANAP2, PCANAP6, PCANAP8, PRST
Definition
(RefSeq) solute carrier family 45 member 3
  KO
K15379  solute carrier family 45, member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    85414 (SLC45A3)
   05206 MicroRNAs in cancer
    85414 (SLC45A3)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC45: H+/sugar cotransporter
   85414 (SLC45A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1 MFS_2
Motif
Other DBs
NCBI-GeneID: 85414
NCBI-ProteinID: NP_149093
OMIM: 605097
HGNC: 8642
Ensembl: ENSG00000158715
Vega: OTTHUMG00000037223
Pharos: Q96JT2(Tbio)
UniProt: Q96JT2
Position
1q32.1
AA seq 553 aa AA seqDB search
MVQRLWVSRLLRHRKAQLLLVNLLTFGLEVCLAAGITYVPPLLLEVGVEEKFMTMVLGIG
PVLGLVCVPLLGSASDHWRGRYGRRRPFIWALSLGILLSLFLIPRAGWLAGLLCPDPRPL
ELALLILGVGLLDFCGQVCFTPLEALLSDLFRDPDHCRQAYSVYAFMISLGGCLGYLLPA
IDWDTSALAPYLGTQEECLFGLLTLIFLTCVAATLLVAEEAALGPTEPAEGLSAPSLSPH
CCPCRARLAFRNLGALLPRLHQLCCRMPRTLRRLFVAELCSWMALMTFTLFYTDFVGEGL
YQGVPRAEPGTEARRHYDEGVRMGSLGLFLQCAISLVFSLVMDRLVQRFGTRAVYLASVA
AFPVAAGATCLSHSVAVVTASAALTGFTFSALQILPYTLASLYHREKQVFLPKYRGDTGG
ASSEDSLMTSFLPGPKPGAPFPNGHVGAGGSGLLPPPPALCGASACDVSVRVVVGEPTEA
RVVPGRGICLDLAILDSAFLLSQVAPSLFMGSIVQLSQSVTAYMVSAAGLGLVAIYFATQ
VVFDKSDLAKYSA
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggtccagaggctgtgggtgagccgcctgctgcggcaccggaaagcccagctcttgctg
gtcaacctgctaacctttggcctggaggtgtgtttggccgcaggcatcacctatgtgccg
cctctgctgctggaagtgggggtagaggagaagttcatgaccatggtgctgggcattggt
ccagtgctgggcctggtctgtgtcccgctcctaggctcagccagtgaccactggcgtgga
cgctatggccgccgccggcccttcatctgggcactgtccttgggcatcctgctgagcctc
tttctcatcccaagggccggctggctagcagggctgctgtgcccggatcccaggcccctg
gagctggcactgctcatcctgggcgtggggctgctggacttctgtggccaggtgtgcttc
actccactggaggccctgctctctgacctcttccgggacccggaccactgtcgccaggcc
tactctgtctatgccttcatgatcagtcttgggggctgcctgggctacctcctgcctgcc
attgactgggacaccagtgccctggccccctacctgggcacccaggaggagtgcctcttt
ggcctgctcaccctcatcttcctcacctgcgtagcagccacactgctggtggctgaggag
gcagcgctgggccccaccgagccagcagaagggctgtcggccccctccttgtcgccccac
tgctgtccatgccgggcccgcttggctttccggaacctgggcgccctgcttccccggctg
caccagctgtgctgccgcatgccccgcaccctgcgccggctcttcgtggctgagctgtgc
agctggatggcactcatgaccttcacgctgttttacacggatttcgtgggcgaggggctg
taccagggcgtgcccagagctgagccgggcaccgaggcccggagacactatgatgaaggc
gttcggatgggcagcctggggctgttcctgcagtgcgccatctccctggtcttctctctg
gtcatggaccggctggtgcagcgattcggcactcgagcagtctatttggccagtgtggca
gctttccctgtggctgccggtgccacatgcctgtcccacagtgtggccgtggtgacagct
tcagccgccctcaccgggttcaccttctcagccctgcagatcctgccctacacactggcc
tccctctaccaccgggagaagcaggtgttcctgcccaaataccgaggggacactggaggt
gctagcagtgaggacagcctgatgaccagcttcctgccaggccctaagcctggagctccc
ttccctaatggacacgtgggtgctggaggcagtggcctgctcccacctccacccgcgctc
tgcggggcctctgcctgtgatgtctccgtacgtgtggtggtgggtgagcccaccgaggcc
agggtggttccgggccggggcatctgcctggacctcgccatcctggatagtgccttcctg
ctgtcccaggtggccccatccctgtttatgggctccattgtccagctcagccagtctgtc
actgcctatatggtgtctgccgcaggcctgggtctggtcgccatttactttgctacacag
gtagtatttgacaagagcgacttggccaaatactcagcgtag

DBGET integrated database retrieval system