KEGG   Homo sapiens (human): 85476Help
Entry
85476             CDS       T01001                                 

Gene name
GFM1, COXPD1, EFG, EFG1, EFGM, EGF1, GFM, hEFG1
Definition
(RefSeq) G elongation factor, mitochondrial 1
  KO
K02355  
elongation factor G
Organism
hsa  Homo sapiens (human)
Disease
H00891  
Combined oxidative phosphorylation deficiency (COXPD)
Brite
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    85476 (GFM1)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    85476 (GFM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q25
AA seq 770 aa AA seqDB search
MRLLGAAAVAALGRGRAPASLGWQRKQVNWKACRWSSSGVIPNEKIRNIGISAHIDSGKT
TLTERVLYYTGRIAKMHEVKGKDGVGAVMDSMELERQRGITIQSAATYTMWKDVNINIID
TPGHVDFTIEVERALRVLDGAVLVLCAVGGVQCQTMTVNRQMKRYNVPFLTFINKLDRMG
SNPARALQQMRSKLNHNAAFMQIPMGLEGNFKGIVDLIEERAIYFDGDFGHFLRDFLPLL
WNWDRRSGSQIVRYGEIPAELRAAATDHRQELIECVANSDEQLGEMFLEEKIPSISDLKL
AIRRATLKRSFTPVFLGSALKNKGVQPLLDAVLEYLPNPSEVQNYAILNKEDDSKEKTKI
LMNSSRDNSHPFVGLAFKLEVGRFGQLTYVRSYQGELKKGDTIYNTRTRKKVRLQRLARM
HADMMEDVEEVYAGDICALFGIDCASGDTFTDKANSGLSMESIHVPDPVISIAMKPSNKN
DLEKFSKGIGRFTREDPTFKVYFDTENKETVISGMGELHLEIYAQRLEREYGCPCITGKP
KVAFRETITAPVPFDFTHKKQSGGAGQYGKVIGVLEPLDPEDYTKLEFSDETFGSNIPKQ
FVPAVEKGFLDACEKGPLSGHKLSGLRFVLQDGAHHMVDSNEISFIRAGEGALKQALANA
TLCILEPIMAVEVVAPNEFQGQVIAGINRRHGVITGQDGVEDYFTLYADVPLNDMFGYST
ELRSCTEGKGEYTMEYSRYQPCLPSTQEDVINKYLEATGQLPVKKGKAKN
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgagactcctgggagctgcagccgtcgcggctctggggcgcggaagggcccccgcctcc
ctaggctggcagaggaagcaggttaattggaaggcctgccgatggtcttcatcaggggtg
attcctaatgaaaaaatacgaaatattggaatctcagctcacattgattctgggaaaact
acattaacagaacgagtcctttactacactggcagaattgcaaagatgcatgaggtgaaa
ggtaaagatggagttggtgctgtcatggattccatggaactagagagacaaagaggaatc
actattcagtcagcagccacttacaccatgtggaaagatgtcaatattaacattatagat
actcctgggcatgtggacttcacaatagaagtggaaagggccctgagagtgttggatggt
gcagtccttgttctctgtgctgttggaggggtacagtgccagaccatgactgtcaatcgt
cagatgaagcgctacaacgttccgtttctaacttttattaacaaattggaccgaatgggc
tccaacccagccagggccctgcagcaaatgaggtctaaactaaatcataatgcagcgttt
atgcagatacccatgggtttggagggtaattttaaaggtattgtagatcttattgaggaa
cgagccatctattttgatggagactttgggcacttcctgagggatttccttcctctgcta
tggaattgggatcgcaggtctggcagtcagattgttcgatatggtgagattccagctgaa
ttaagggcggcggccactgaccaccggcaggagctaattgaatgtgttgccaattcagat
gaacagcttggtgagatgtttctggaagaaaaaatcccctcgatttctgatttaaagcta
gcaattcgaagagctactctgaaaagatcatttactcctgtatttttgggaagcgccttg
aagaacaaaggagttcagcctcttttagatgctgttttagaatacctcccaaatccatct
gaagtccagaactatgctattctcaataaagaggatgactcaaaagagaaaaccaaaatc
ctaatgaactccagtagagacaattcccacccatttgtaggcctggcttttaaactggag
gtaggtcgatttggacaattaacttatgttcgcagttatcagggagagctaaagaagggt
gacaccatctataacacaaggacaagaaagaaagtacggttgcaacggctggctcgcatg
catgccgacatgatggaggatgttgaggaagtatatgccggagacatctgtgcattgttt
ggcattgactgtgctagtggagacacattcacagacaaagccaacagcggcctttctatg
gagtcaattcatgttcctgatcctgtcatttcaatagcaatgaagccttctaacaagaac
gatctggaaaaattttcaaaaggtattggcaggtttacaagagaagatcccacatttaaa
gtatactttgacactgagaacaaagagacagttatatctggaatgggagaattacacctg
gaaatctatgctcagaggctggaaagagagtatggctgtccttgtatcacaggaaagcca
aaagttgcctttcgagagaccattactgcccctgtcccgtttgactttacacataaaaaa
caatcaggtggtgcaggccagtatggaaaagtaataggtgtcctggagcctctggaccca
gaggactacactaaattggaattttcagatgaaacattcggatcaaatattccaaagcag
tttgtgcctgctgtagaaaaggggtttttagatgcctgcgagaagggccctctttctggt
cacaagctctctgggctccggtttgtcctgcaagatggagcacaccacatggttgattct
aatgaaatctctttcatccgagcaggagaaggtgctcttaaacaagccttggcaaatgca
acattatgtattcttgaacctattatggctgtggaagttgtagctccaaatgaatttcag
ggacaagtaattgcaggaattaaccgacgccatggggtaatcactgggcaagatggagtt
gaggactattttacactgtatgcagatgtccctctaaatgatatgtttggttattccact
gaacttaggtcatgcacagagggaaagggagaatacacaatggagtatagcaggtatcag
ccatgtttaccatccacacaagaagacgtcattaataagtatttggaagctacaggtcaa
cttcctgttaaaaaaggaaaagccaagaactaa

DBGET integrated database retrieval system