KEGG   Homo sapiens (human): 85477Help
Entry
85477             CDS       T01001                                 

Gene name
SCIN
Definition
scinderin
Orthology
K05768  
gelsolin
Organism
hsa  Homo sapiens (human)
Pathway
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    85477 (SCIN)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    85477 (SCIN)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    85477 (SCIN)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   85477 (SCIN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7p21.3
AA seq 715 aa AA seqDB search
MARELYHEEFARAGKQAGLQVWRIEKLELVPVPQSAHGDFYVGDAYLVLHTAKTSRGFTY
HLHFWLGKECSQDESTAAAIFTVQMDDYLGGKPVQNRELQGYESNDFVSYFKGGLKYKAG
GVASGLNHVLTNDLTAKRLLHVKGRRVVRATEVPLSWDSFNKGDCFIIDLGTEIYQWCGS
SCNKYERLKANQVATGIRYNERKGRSELIVVEEGSEPSELIKVLGEKPELPDGGDDDDII
ADISNRKMAKLYMVSDASGSMRVTVVAEENPFSMAMLLSEECFILDHGAAKQIFVWKGKD
ANPQERKAAMKTAEEFLQQMNYSKNTQIQVLPEGGETPIFKQFFKDWRDKDQSDGFGKVY
VTEKVAQIKQIPFDASKLHSSPQMAAQHNMVDDGSGKVEIWRVENNGRIQVDQNSYGEFY
GGDCYIILYTYPRGQIIYTWQGANATRDELTTSAFLTVQLDRSLGGQAVQIRVSQGKEPV
HLLSLFKDKPLIIYKNGTSKKGGQAPAPPTRLFQVRRNLASITRIVEVDVDANSLNSNDV
FVLKLPQNSGYIWVGKGASQEEEKGAEYVASVLKCKTLRIQEGEEPEEFWNSLGGKKDYQ
TSPLLETQAEDHPPRLYGCSNKTGRFVIEEIPGEFTQDDLAEDDVMLLDAWEQIFIWIGK
DANEVEKKESLKSAKMYLETDPSGRDKRTPIVIIKQGHEPPTFTGWFLGWDSSKW
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgggagctataccacgaagagttcgcccgggcgggcaagcaggcggggctgcag
gtctggaggattgagaagctggagctggtgcccgtgccccagagcgctcacggcgacttc
tacgtcggggatgcctacctggtgctgcacacggccaagacgagccgaggcttcacctac
cacctgcacttctggctcggaaaggagtgttcccaggatgaaagcacagctgctgccatc
ttcactgttcagatggatgactatttgggtggcaagccagtgcagaatagagaacttcaa
ggatatgagtctaatgactttgttagctatttcaaaggcggtctgaaatacaaggctgga
ggcgtggcatctggattaaatcatgttcttacgaacgacctgacagccaagaggctccta
catgtgaagggtcgtagagtggtgagagccacagaagttccccttagctgggacagtttc
aacaagggtgactgcttcatcattgaccttggcaccgaaatttatcagtggtgtggttcc
tcgtgcaacaaatatgaacgtctgaaggcaaaccaggtagctactggcattcggtacaat
gaaaggaaaggaaggtctgaactaattgtcgtggaagaaggaagtgaaccctcagaactt
ataaaggtcttaggggaaaagccagagcttccagatggaggtgatgatgatgacattata
gcagacataagtaacaggaaaatggctaaactatacatggtttcagatgcaagtggctcc
atgagagtgactgtggtggcagaagaaaaccccttctcaatggcaatgctgctgtctgaa
gaatgctttattttggaccacggggctgccaaacaaattttcgtatggaaaggtaaagat
gctaatccccaagagaggaaggctgcaatgaagacagctgaagaatttctacagcaaatg
aattattccaagaatacccaaattcaagttcttccagaaggaggtgaaacaccaatcttc
aaacagttttttaaggactggagagataaagatcagagtgatggcttcgggaaagtttat
gtcacagagaaagtggctcaaataaaacaaattccctttgatgcctcaaaattacacagt
tctccgcagatggcagcccagcacaatatggtggatgatggttctggcaaagtggagatt
tggcgtgtagaaaacaatggtaggatccaagttgaccaaaactcatatggtgaattctat
ggtggtgactgctacatcatactctacacctatcccagaggacagattatctacacgtgg
caaggagcaaatgccacacgagatgagctgacaacatctgcgttcctgactgttcagttg
gatcggtcccttggaggacaggctgtgcagatccgagtctcccaaggcaaagagcctgtt
cacctactgagtttgttcaaagacaaaccgctcattatttacaagaatggaacatcaaag
aaaggaggtcaggcacctgctccccctacacgcctctttcaagtccggagaaacctggca
tctatcaccagaattgtggaggttgatgttgatgcaaattcactgaattctaacgatgtt
tttgtcctgaaactgccacaaaatagtggctacatctgggtaggaaaaggtgctagccag
gaggaggagaaaggagcagagtatgtagcaagtgtcctaaagtgcaaaaccttaaggatc
caagaaggcgaggagccagaggagttctggaattcccttggagggaaaaaagactaccag
acctcaccactactggaaacccaggctgaagaccatccacctcggctttacggctgctct
aacaaaactggaagatttgttattgaagagattccaggagagttcacccaggatgattta
gctgaagatgatgtcatgttactagatgcttgggaacagatatttatttggattggcaaa
gatgctaatgaagttgagaaaaaagaatctctgaagtctgccaaaatgtaccttgagaca
gacccttctggaagagacaagaggacaccaattgtcatcataaaacagggccatgagcca
cccacattcacaggctggttcctgggctgggattccagcaagtggtaa

DBGET integrated database retrieval system