KEGG   Homo sapiens (human): 85479Help
Entry
85479             CDS       T01001                                 

Gene name
DNAJC5B, CSP-beta
Definition
DnaJ (Hsp40) homolog, subfamily C, member 5 beta
Orthology
K09525  
DnaJ homolog subfamily C member 5
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    85479 (DNAJC5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q13.1
AA seq 199 aa AA seqDB search
MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYRKLALKHHPDKNPDDPAATEK
FKEINNAHAILTDISKRSIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKALFVIVGLL
TGCYFCCCLCCCCNCCCGHCRPESSVPEEDFYVSPEDLEEQIKSDMEKDVDFPVFLQPTN
ANEKTQLIKEGSRSYCTDS
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcatgtaacatacctaaccaaagacagcggactctgtcaacaacaggagaagctcta
tacgaaattcttggtctgcataagggagcatcaaatgaagaaattaagaaaacctacaga
aaattggccctgaaacaccatccagacaagaatccagatgatccagctgctactgagaag
tttaaagaaatcaacaacgcccacgcaatacttaccgacatttcaaagagaagcatatac
gacaagtacggatcgctgggactctacgtggccgagcagtttggagacgaaaacgttaac
acctacttcatgctgtcgagctggtgggcaaaggccctgtttgtcatcgttggcctcttg
acgggctgctacttttgctgctgcctgtgctgctgctgcaactgctgctgtggacactgc
cggcccgagtcatcagtgccagaagaggacttctatgtgtccccagaggatctggaggag
cagatcaagtctgacatggaaaaagatgtggactttccagtttttctccagcctacaaat
gcaaatgagaaaacacagctaatcaaagaaggatctcgaagttattgcacagactcttga

DBGET integrated database retrieval system