KEGG   Homo sapiens (human): 85479Help
Entry
85479             CDS       T01001                                 

Gene name
DNAJC5B, CSP-beta
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member C5 beta
  KO
K09525  DnaJ homolog subfamily C member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    85479 (DNAJC5B)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   85479 (DNAJC5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DnaJ EMP70
Motif
Other DBs
NCBI-GeneID: 85479
NCBI-ProteinID: NP_149096
OMIM: 613945
HGNC: 24138
Ensembl: ENSG00000147570
Vega: OTTHUMG00000164470
Pharos: Q9UF47(Tdark)
UniProt: Q9UF47 A0A024R7Z1
Position
8q13.1
AA seq 199 aa AA seqDB search
MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYRKLALKHHPDKNPDDPAATEK
FKEINNAHAILTDISKRSIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKALFVIVGLL
TGCYFCCCLCCCCNCCCGHCRPESSVPEEDFYVSPEDLEEQIKSDMEKDVDFPVFLQPTN
ANEKTQLIKEGSRSYCTDS
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcatgtaacatacctaaccaaagacagcggactctgtcaacaacaggagaagctcta
tacgaaattcttggtctgcataagggagcatcaaatgaagaaattaagaaaacctacaga
aaattggccctgaaacaccatccagacaagaatccagatgatccagctgctactgagaag
tttaaagaaatcaacaacgcccacgcaatacttaccgacatttcaaagagaagcatatac
gacaagtacggatcgctgggactctacgtggccgagcagtttggagacgaaaacgttaac
acctacttcatgctgtcgagctggtgggcaaaggccctgtttgtcatcgttggcctcttg
acgggctgctacttttgctgctgcctgtgctgctgctgcaactgctgctgtggacactgc
cggcccgagtcatcagtgccagaagaggacttctatgtgtccccagaggatctggaggag
cagatcaagtctgacatggaaaaagatgtggactttccagtttttctccagcctacaaat
gcaaatgagaaaacacagctaatcaaagaaggatctcgaagttattgcacagactcttga

DBGET integrated database retrieval system