KEGG   Homo sapiens (human): 85480Help
Entry
85480             CDS       T01001                                 

Gene name
TSLP
Definition
thymic stromal lymphopoietin
Orthology
K05436  
thymic stromal lymphopoietin
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Disease
H01361  
Eosinophilic esophagitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    85480 (TSLP)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    85480 (TSLP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q22.1
AA seq 159 aa AA seqDB search
MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKS
TEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINA
TQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgttcccttttgccttactatatgttctgtcagtttctttcaggaaaatcttcatctta
caacttgtagggctggtgttaacttacgacttcactaactgtgactttgagaagattaaa
gcagcctatctcagtactatttctaaagacctgattacatatatgagtgggaccaaaagt
accgagttcaacaacaccgtctcttgtagcaatcggccacattgccttactgaaatccag
agcctaaccttcaatcccaccgccggctgcgcgtcgctcgccaaagaaatgttcgccatg
aaaactaaggctgccttagctatctggtgcccaggctattcggaaactcagataaatgct
actcaggcaatgaagaagaggagaaaaaggaaagtcacaaccaataaatgtctggaacaa
gtgtcacaattacaaggattgtggcgtcgcttcaatcgacctttactgaaacaacagtaa

DBGET integrated database retrieval system