KEGG   Homo sapiens (human): 85480Help
Entry
85480             CDS       T01001                                 

Gene name
TSLP
Definition
(RefSeq) thymic stromal lymphopoietin
  KO
K05436  thymic stromal lymphopoietin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
Disease
H01361  Eosinophilic esophagitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    85480 (TSLP)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    85480 (TSLP)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   85480 (TSLP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSLP
Motif
Other DBs
NCBI-GeneID: 85480
NCBI-ProteinID: NP_149024
OMIM: 607003
HGNC: 30743
Ensembl: ENSG00000145777
Vega: OTTHUMG00000128791
Pharos: Q969D9(Tbio)
UniProt: Q969D9
Structure
PDB: 

Jmol
Position
5q22.1
AA seq 159 aa AA seqDB search
MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKS
TEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINA
TQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgttcccttttgccttactatatgttctgtcagtttctttcaggaaaatcttcatctta
caacttgtagggctggtgttaacttacgacttcactaactgtgactttgagaagattaaa
gcagcctatctcagtactatttctaaagacctgattacatatatgagtgggaccaaaagt
accgagttcaacaacaccgtctcttgtagcaatcggccacattgccttactgaaatccag
agcctaaccttcaatcccaccgccggctgcgcgtcgctcgccaaagaaatgttcgccatg
aaaactaaggctgccttagctatctggtgcccaggctattcggaaactcagataaatgct
actcaggcaatgaagaagaggagaaaaaggaaagtcacaaccaataaatgtctggaacaa
gtgtcacaattacaaggattgtggcgtcgcttcaatcgacctttactgaaacaacagtaa

DBGET integrated database retrieval system