KEGG   Homo sapiens (human): 8550Help
Entry
8550              CDS       T01001                                 

Gene name
MAPKAPK5, MAPKAP-K5, MK-5, MK5, PRAK
Definition
mitogen-activated protein kinase-activated protein kinase 5 (EC:2.7.11.1)
Orthology
K04442  
mitogen-activated protein kinase-activated protein kinase 5 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    8550 (MAPKAPK5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     8550 (MAPKAPK5)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  MAPKAPK family [OT]
   8550 (MAPKAPK5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.13
AA seq 471 aa AA seqDB search
MSEESDMDKAIKETSILEEYSINWTQKLGAGISGPVRVCVKKSTQERFALKILLDRPKAR
NEVRLHMMCATHPNIVQIIEVFANSVQFPHESSPRARLLIVMEMMEGGELFHRISQHRHF
TEKQASQVTKQIALALRHCHLLNIAHRDLKPENLLFKDNSLDAPVKLCDFGFAKIDQGDL
MTPQFTPYYVAPQVLEAQRRHQKEKSGIIPTSPTPYTYNKSCDLWSLGVIIYVMLCGYPP
FYSKHHSRTIPKDMRRKIMTGSFEFPEEEWSQISEMAKDVVRKLLKVKPEERLTIEGVLD
HPWLNSTEALDNVLPSAQLMMDKAVVAGIQQAHAEQLANMRIQDLKVSLKPLHSVNNPIL
RKRKLLGTKPKDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGENEDEKLNEVMQEA
WKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSHESQ
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaggagagcgacatggacaaagccatcaaggaaacttccattttagaagaatac
agtatcaattggactcagaagctgggagctggaattagtggtccagttagagtctgtgta
aagaaatctactcaagaacggtttgcgctgaaaattcttcttgatcgtccaaaagctaga
aatgaggtacgtctgcacatgatgtgtgccacacacccaaacatagttcagattattgaa
gtgtttgctaacagtgtccagtttccccatgagtccagccctagggcccgactcttaatt
gtaatggagatgatggaagggggagagctatttcacagaatcagccagcaccggcacttt
acagagaagcaagccagccaagtaacaaagcagatagctttggctctgcggcactgtcac
ttgttaaacattgcgcacagagacctcaagcctgaaaatctgctttttaaggataactct
ttggatgccccagtgaagttgtgtgactttggatttgccaagattgaccaaggtgacttg
atgacaccccagttcaccccttattatgtagcaccccaggtactggaggcgcaaagaagg
catcagaaggagaaatctggcatcatacctacctcaccgacgccctacacttacaacaag
agctgtgacttgtggtccctaggggtgattatctatgtgatgctgtgcggataccctcct
ttttactccaaacaccacagccggactatcccaaaggatatgcgaagaaagatcatgaca
ggcagttttgagttcccagaggaagagtggagtcagatctcagagatggccaaagatgtt
gtgaggaagctcctgaaggtcaaaccggaggagagactcaccatcgagggagtgctggac
cacccctggctcaattccaccgaggccctggataatgtgctgccttctgctcagctgatg
atggacaaggcagtggttgcaggaatccagcaggctcacgcggaacagttggccaacatg
agaatccaggatctgaaagtcagcctcaaacccctgcactcagtgaacaaccccattctg
cggaagaggaagttacttggcaccaagccaaaggacagtgtctatatccacgaccatgag
aatggagccgaggattccaatgttgccttggaaaaactccgagatgtgattgctcagtgt
attctcccccaggctggagagaatgaagatgagaaactgaatgaagtaatgcaggaggct
tggaagtataaccgggaatgcaaactcctaagagatactctgcagagcttcagctggaat
ggtcgtggattcacagataaagtagatcgactaaaactggcagaaattgtgaagcaggtg
atagaagagcaaaccacgtcccacgaatcccaataa

DBGET integrated database retrieval system