KEGG   Homo sapiens (human): 8554Help
Entry
8554              CDS       T01001                                 

Gene name
PIAS1, DDXBP1, GBP, GU/RH-II, ZMIZ3
Definition
protein inhibitor of activated STAT, 1
Orthology
K04706  
E3 SUMO-protein ligase PIAS1 [EC:6.3.2.-]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Jak-STAT signaling pathway
Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    8554 (PIAS1)
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    8554 (PIAS1)
 Human Diseases
  Infectious diseases
   05160 Hepatitis C
    8554 (PIAS1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.-  
     8554 (PIAS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q
AA seq 651 aa AA seqDB search
MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
YRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHEL
ELPHLTSALHPVHPDIKLQKLPFYDLLDELIKPTSLASDNSQRFRETCFAFALTPQQVQQ
ISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNYSMAVYLVKQLSSTVLLQRLRAK
GIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALTCSHLQCFDAT
LYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRT
CPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDL
QGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTS
LPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISLD
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atggcggacagtgcggaactaaagcaaatggttatgagccttagagtttctgaactccaa
gtactgttgggctacgccgggagaaacaagcacggacgcaaacacgaacttctcacaaaa
gccctgcatttgctaaaggctggctgtagtcctgctgtgcaaatgaaaattaaggaactc
tataggcggcggttcccacagaaaatcatgacgcctgcagacttgtccatccccaacgta
cattcaagtcctatgccagcaactttgtctccatctaccattccacaactcacttacgat
ggtcaccctgcatcatcgccattactccctgtttctcttctgggacctaaacatgaactg
gaactcccacatcttacatcagctcttcacccagtccatccggatataaaacttcaaaaa
ttaccattttatgatttactggatgaactgataaaacccaccagtctagcatcagacaac
agtcagcgctttcgagaaacctgttttgcatttgccttgacaccacaacaagtgcagcaa
atcagtagttccatggatatttctgggaccaaatgtgacttcacagtacaggtccagtta
aggttttgtttatcagaaaccagttgtccacaagaagatcacttcccacccaatctttgt
gtgaaagtgaatacaaaaccttgcagccttccaggttaccttccacctacaaaaaatggc
gtggaaccaaagcgacccagccgaccaattaatatcacctcacttgtccgactgtccaca
acagtaccaaacacgattgttgtttcttggactgcagaaattggaagaaactattccatg
gcagtatatcttgtaaaacagttgtcctcaacagttcttcttcagaggttacgagcaaag
ggaataaggaatccggatcattctagagctttaattaaagagaagttgactgcggatcca
gacagtgaaatagctacaaccagcctaagggtttctctactatgtccacttggtaaaatg
cggctgacaattccgtgtcgggcccttacatgttctcatctacaatgttttgacgcaact
ctttacattcagatgaatgagaaaaaaccaacctgggtttgtcctgtctgtgataagaag
gctccatatgaacaccttattattgatggcttgtttatggaaatcctaaagtactgtaca
gactgtgatgaaatacaatttaaggaggatggcacttgggcaccgatgagatcaaaaaag
gaagtacaggaagtttctgcctcttacaatggagtcgatggatgcttgagctccacattg
gagcatcaggtagcgtctcaccaccagtcctcaaataaaaacaagaaagtagaagtgatt
gacctaaccatagacagttcatctgatgaagaggaagaagagccatctgccaagaggacc
tgtccttccctatctcccacatcaccactaaataataaaggcattttaagtcttccacat
caagcatctccagtatcccgcaccccaagccttcctgctgtagacacaagctacattaat
acctccctcatccaagactataggcatcctttccacatgacacccatgccttacgactta
caaggattagatttctttcctttcttatcaggagacaatcagcattacaacacctccttg
cttgccgctgcagcagcagcagtttcagatgatcaagacctcctacactcgtctcggttt
ttcccgtatacctcctcacagatgtttcttgatcagttaagtgcaggaggcagtacttct
ctgccaaccaccaatggaagcagtagtggcagtaacagcagcctggtttcttccaacagc
ctaagggaaagccatagccacaccgtcacaaacaggagcagcacggacacggcatccatc
tttggcatcataccagacattatttcattggactga

DBGET integrated database retrieval system