KEGG   Homo sapiens (human): 8555Help
Entry
8555              CDS       T01001                                 

Gene name
CDC14B, CDC14B3, Cdc14B1, Cdc14B2, hCDC14B
Definition
cell division cycle 14B (EC:3.1.3.16 3.1.3.48)
Orthology
K06639  
cell division cycle 14 [EC:3.1.3.16 3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    8555 (CDC14B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     8555 (CDC14B)
    3.1.3.48  protein-tyrosine-phosphatase
     8555 (CDC14B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q22.3
AA seq 461 aa AA seqDB search
MSREGAGAALVAEVIKDRLCFAILYSRPKSASNVHYFSIDNELEYENFYADFGPLNLAMV
YRYCCKINKKLKSITMLRKKIVHFTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIF
GETSYIPFRDAAYGSCNFYITLLDCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLN
WIIPDRFIAFCGPHSRARLESGYHQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAG
FDHHDLFFADGSTPTDAIVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTA
AETIAWVRICRPGSVIGPQQQFLVMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLSGV
DDISINGVENQDQQEPEPYSDDDEINGVTQGDRLRALKSRRQSKTNAIPLTVILQSSVQS
CKTSEPNISGSAGITKRTTRSASRKSSVKSLSISRTKTVLR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgagccgggagggcgcgggggcagctttggtagccgaggtgatcaaagatcgcctttgt
tttgccattctctacagcagaccaaagagtgcatcaaatgtacattatttcagcatagat
aatgaacttgaatatgagaacttctacgcagattttggaccactcaatctggcaatggtt
tacagatattgttgcaagatcaataagaaattaaagtccattacaatgttaaggaagaaa
attgttcattttactggctctgatcagagaaaacaagcaaatgctgccttccttgttgga
tgctacatggttatatatttggggagaaccccagaagaagcatatagaatattaatcttt
ggagagacatcctatattcctttcagagatgctgcctatggaagttgcaatttctacatt
acacttcttgactgttttcatgcagtaaagaaggcaatgcagtatggcttccttaatttc
aactcatttaaccttgatgaatatgaacactatgaaaaagcagaaaatggagatttaaat
tggataataccagaccgatttattgccttctgtggacctcattcaagagccagacttgaa
agtggttaccaccaacattctcctgagacttatattcaatattttaagaatcacaatgtt
actaccattattcgtctgaataaaaggatgtatgatgccaaacgctttacggatgctggc
ttcgatcaccatgatcttttctttgcggatggcagcacccctactgatgccattgtcaaa
gaattcctagatatctgtgaaaatgctgagggtgccattgcagtacattgcaaagctggc
cttggtcgcacgggcactctgatagcctgctacatcatgaagcattacaggatgacagca
gccgagaccattgcgtgggtcaggatctgcagacctggctcggtgattgggcctcagcag
cagtttttggtgatgaagcaaaccaacctctggctggaaggggactattttcgtcagaag
ttaaaggggcaggagaatggacaacacagagcagccttctccaaacttctctctggcgtt
gatgacatttccataaatggggtcgagaatcaagatcagcaagaacccgaaccgtacagt
gatgatgacgaaatcaatggagtgacacaaggtgatagacttcgggccttgaaaagcaga
agacaatccaaaacaaacgctattcctctcacagtaattcttcaatccagtgttcagagc
tgtaaaacatctgaacctaacatttctggcagtgcaggcattactaaaagaaccaccaga
tctgcttcaaggaaaagcagtgttaaaagtctctccatttcaaggactaaaacagtcttg
cgttaa

DBGET integrated database retrieval system