KEGG   Homo sapiens (human): 8556Help
Entry
8556              CDS       T01001                                 

Gene name
CDC14A, cdc14, hCDC14
Definition
cell division cycle 14A (EC:3.1.3.16 3.1.3.48)
Orthology
K06639  
cell division cycle 14 [EC:3.1.3.16 3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    8556 (CDC14A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     8556 (CDC14A)
    3.1.3.48  protein-tyrosine-phosphatase
     8556 (CDC14A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p21
AA seq 594 aa AA seqDB search
MAAESGELIGACEFMKDRLYFATLRNRPKSTVNTHYFSIDEELVYENFYADFGPLNLAMV
YRYCCKLNKKLKSYSLSRKKIVHYTCFDQRKRANAAFLIGAYAVIYLKKTPEEAYRALLS
GSNPPYLPFRDASFGNCTYNLTILDCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDF
NWIVPGKFLAFSGPHPKSKIENGYPLHAPEAYFPYFKKHNVTAVVRLNKKIYEAKRFTDA
GFEHYDLFFIDGSTPSDNIVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFT
HAEIIAWIRICRPGSIIGPQQHFLEEKQASLWVQGDIFRSKLKNRPSSEGSINKILSGLD
DMSIGGNLSKTQNMERFGEDNLEDDDVEMKNGITQGDKLRALKSQRQPRTSPSCAFRSDD
TKGHPRAVSQPFRLSSSLQGSAVTLKTSKMALSPSATAKRINRTSLSSGATVRSFSINSR
LASSLGNLNAATDDPENKKTSSSSKAGFTASPFTNLLNGSSQPTTRNYPELNNNQYNRSS
NSNGGNLNSPPGPHSAKTEEHTTILRPSYTGLSSSSARFLSRSIPSLQSEYVHY
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggagtcaggggaactaatcggggcttgtgagttcatgaaagatcggttatat
tttgctactttaaggaatagaccaaaaagcacagtaaatacccactatttctccatcgat
gaggagctggtctatgaaaatttctatgcagattttggaccgctgaacttggcaatggtg
tacagatattgctgcaaactaaacaagaaactaaaatcatacagtttgtcaagaaagaaa
atagtgcactacacctgttttgaccaacggaaaagagcaaatgcagcatttttgataggt
gcctatgcagtaatctatttaaagaagacaccagaagaagcctacagagcactcctgtct
ggctcaaaccccccctatcttccattcagggatgcttcctttggaaattgcacttacaat
ctcaccattctcgactgtttgcagggaatcagaaagggattacaacatggattttttgac
tttgagacatttgatgtggatgaatatgaacattatgagcgagttgaaaatggtgacttc
aactggattgttccaggaaaatttttagcatttagtggaccacatcctaaaagcaaaatt
gagaatggttatcctcttcacgcccctgaagcctactttccttatttcaaaaagcataat
gtgactgcagttgtgaggctaaacaaaaagatttatgaggcaaagcgcttcacagacgct
ggcttcgagcactatgacctcttcttcatagatggcagcacacccagtgacaacatcgtg
cgaaggttcctgaacatctgtgagaacaccgaaggggccatcgccgttcactgcaaagct
ggtcttggaagaacagggacattgatagcctgttatgtaatgaaacactacaggtttaca
catgctgaaataattgcttggattagaatatgccggccaggctctattataggaccccag
cagcacttcctggaagaaaaacaagcatcgttgtgggtccaaggagacattttccgatcc
aaactgaaaaatcgaccatccagtgaaggaagtattaataaaattctttctggcctagat
gatatgtctattggtggaaatctttcaaaaacacaaaacatggaacgatttggagaggat
aacttagaagatgatgatgtggaaatgaaaaatggtataacccagggagacaaactacgt
gccttaaaaagtcagagacagccacgtacctcaccatcctgtgcatttaggtcagatgat
acaaaaggacatccaagagcagtgtcccagcctttcagattaagttcatccctgcaagga
tctgcagttactttgaagacatcaaaaatggcactgtccccttcagcaacggccaagagg
atcaacagaacttctttgtcttcgggtgccactgtaagaagcttttccataaactcccgg
ctagccagttctctagggaacttgaatgctgcaacagatgatccagagaacaaaaagacc
tcctcatcctctaaggcaggcttcacagccagcccgtttaccaacctcttgaatggcagc
tcccagccaactaccagaaattaccctgagctcaacaataatcagtacaacagaagcagc
aacagcaacgggggcaacctgaacagccccccaggcccccacagcgccaagacagaggag
cacaccaccatcctccgaccctcctacaccgggctttcttcttcttcagcgagattcctg
agccgttctatcccttcccttcagtctgaatatgttcattactaa

DBGET integrated database retrieval system