KEGG   Homo sapiens (human): 8569Help
Entry
8569              CDS       T01001                                 

Gene name
MKNK1, MNK1
Definition
MAP kinase interacting serine/threonine kinase 1 (EC:2.7.11.1)
Orthology
K04372  
MAP kinase interacting serine/threonine kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
HIF-1 signaling pathway
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    8569 (MKNK1)
   04066 HIF-1 signaling pathway
    8569 (MKNK1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    8569 (MKNK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     8569 (MKNK1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  MAPKAPK family [Table]
   8569 (MKNK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p33
AA seq 424 aa AA seqDB search
MVSSQKLEKPIEMGSSEPLPIADGDRRRKKKRRGRATDSLPGKFEDMYKLTSELLGEGAY
AKVQGAVSLQNGKEYAVKIIEKQAGHSRSRVFREVETLYQCQGNKNILELIEFFEDDTRF
YLVFEKLQGGSILAHIQKQKHFNEREASRVVRDVAAALDFLHTKGIAHRDLKPENILCES
PEKVSPVKICDFDLGSGMKLNNSCTPITTPELTTPCGSAEYMAPEVVEVFTDQATFYDKR
CDLWSLGVVLYIMLSGYPPFVGHCGADCGWDRGEVCRVCQNKLFESIQEGKYEFPDKDWA
HISSEAKDLISKLLVRDAKQRLSAAQVLQHPWVQGQAPEKGLPTPQVLQRNSSTMDLTLF
AAEAIALNRQLSQHEENELAEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSP
PTAL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggtatcttctcaaaagttggaaaaacctatagagatgggcagtagcgaaccccttccc
atcgcagatggtgacaggaggaggaagaagaagcggaggggccgggccactgactccttg
ccaggaaagtttgaagatatgtacaagctgacctctgaattgcttggagagggagcctat
gccaaagttcaaggtgccgtgagcctacagaatggcaaagagtatgccgtcaaaatcatc
gagaaacaagcagggcacagtcggagtagggtgtttcgagaggtggagacgctgtatcag
tgtcagggaaacaagaacattttggagctgattgagttctttgaagatgacacaaggttt
tacttggtctttgagaaattgcaaggaggttccatcttagcccacatccagaagcaaaag
cacttcaatgagcgagaagccagccgagtggtgcgggacgttgctgctgcccttgacttc
ctgcataccaaaggcattgctcatcgtgatctgaaaccagaaaatatattgtgtgaatct
ccagaaaaggtgtctccagtgaaaatctgtgactttgacttgggcagtgggatgaaactg
aacaactcctgtacccccataaccacaccagagctgaccaccccatgtggctctgcagaa
tacatggcccctgaggtagtggaggtcttcacggaccaggccacattctacgacaagcgc
tgtgacctgtggagcctgggcgtggtcctctacatcatgctgagtggctacccacccttc
gtgggtcactgcggggccgactgtggctgggaccggggcgaggtctgcagggtgtgccag
aacaagctgtttgaaagcatccaggaaggcaagtatgagtttcctgacaaggactgggca
cacatctccagtgaagccaaagacctcatctccaagctcctggtgcgagatgcaaagcag
agacttagcgccgcccaagttctgcagcacccatgggtgcaggggcaagctccagaaaag
ggactccccacgccgcaagtcctccagaggaacagcagcacaatggacctgacgctcttc
gcagctgaggccatcgcccttaaccgccagctatctcagcacgaagagaacgaactagca
gaggagccagaggcactagctgatggcctctgctccatgaagctttcccctccctgcaag
tcacgcctggcccggagacgggccctggcccaggcaggccgtggtgaagacaggagcccg
cccacagcactctga

DBGET integrated database retrieval system