KEGG   Homo sapiens (human): 8573Help
Entry
8573              CDS       T01001                                 

Gene name
CASK, CAGH39, CAMGUK, CMG, FGS4, LIN2, MICPCH, MRXSNA, TNRC8
Definition
(RefSeq) calcium/calmodulin dependent serine protein kinase (EC:2.7.11.1)
  KO
K06103  
calcium/calmodulin-dependent serine protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Disease
H00577  
Syndromic X-linked mental retardation with epilepsy or seizures
H00894  
FG syndrome (FGS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    8573 (CASK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     8573 (CASK)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  CASK family
   8573 (CASK)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    8573 (CASK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp11.4
AA seq 921 aa AA seqDB search
MADDDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLK
REASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASH
YMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGGRV
GTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPR
QWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNA
RRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGLLAAERAVSQVLDSLEEIHAL
TDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYP
ENNDAKELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDM
DMENVTRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREIN
GISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNS
VSDLPSTTQPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGK
LENSKNGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNADL
VTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENG
KNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVL
RTAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRH
LEEAVELVCTAPQWVPVSWVY
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgacgacgtgctgttcgaggatgtgtacgagctgtgcgaggtgatcggaaag
ggtcccttcagtgttgtacgacgatgtatcaacagagaaactgggcaacaatttgctgta
aaaattgttgatgtagccaagttcacatcaagtccagggttaagtacagaagatctaaag
cgggaagccagtatctgtcatatgctgaaacatccacacattgtagagttattggagaca
tatagctcagatggaatgctttacatggttttcgaatttatggatggagcagatctgtgt
tttgaaatcgtaaagcgagctgacgctggttttgtgtacagtgaagctgtagccagccat
tatatgagacagatactggaagctctacgctactgccatgataataacataattcacagg
gatgtgaagccccactgtgttctccttgcctcaaaagaaaactcggcacctgttaaactt
ggaggctttggggtagctattcaattaggggagtctggacttgtagctggaggacgtgtt
ggaacacctcattttatggcaccagaagtggtcaaaagagagccttacggaaagcctgta
gacgtctgggggtgcggtgtgatcctttttatcctgctcagtggttgtttgcctttttac
ggaaccaaggaaagattgtttgaaggcattattaaaggaaaatataagatgaatccaagg
cagtggagccatatctctgaaagtgccaaagacctagtacgtcgcatgctgatgctggat
ccagctgaaaggatcactgtttatgaagcactgaatcacccatggcttaaggagcgggat
cgttacgcctacaagattcatcttccagaaacagtagagcagctgaggaaattcaatgca
aggaggaaactaaagggtgcagtactagccgctgtgtcaagtcacaaattcaactcattc
tatggggatccccctgaagagttaccagatttctccgaagaccctacctcctcaggactt
ctagcagcagaaagagcagtctcacaggtgctggacagcctggaagagattcatgcgctt
acagactgcagtgaaaaggacctagattttctacacagtgttttccaggatcagcatctt
cacacactactagatctgtatgacaaaattaacacaaagtcttcaccacaaatcaggaat
cctccaagcgatgcagtacagagagccaaagaggtattggaagaaatttcatgttaccct
gagaataacgacgcaaaggaactaaagcgtattttaacacaacctcatttcatggcctta
cttcagactcacgacgtagtggcacatgaagtttacagtgatgaagcattgagggtcaca
cctcctcccacctctccctatttaaacggcgattctccagaaagtgctaacggagacatg
gatatggagaatgtgaccagagttcggctggtacagtttcaaaagaacacagatgaacca
atgggaatcactttaaaaatgaatgaactaaatcattgtattgttgcaagaattatgcat
gggggcatgattcacaggcaaggtacacttcatgttggtgatgaaattcgagaaatcaat
ggcatcagtgtggctaaccaaacagtggaacaactgcaaaaaatgcttagggaaatgcgg
gggagtattaccttcaagattgtgccaagttaccgcactcagtcttcgtcctgtgagaga
gattccccttccacttccagacagtccccagctaatggtcatagcagcactaacaattct
gtttcggacttgccatcaactacccaaccaaaaggacgacagatctatgtaagagcacaa
tttgaatatgatccagccaaggatgacctcatcccctgtaaagaagctggcattcgattc
agagttggtgacatcatccagattattagtaaggatgatcataattggtggcagggtaaa
ctggaaaactccaaaaatggaactgcaggtctcattccttctcctgaacttcaggaatgg
cgagtagcttgcattgccatggagaagaccaaacaggagcagcaggccagctgtacttgg
tttggcaagaaaaagaagcagtacaaagataaatatttggcaaagcacaatgcagatctt
gtcacatatgaagaagtagtaaaactgccagcattcaagaggaaaacactagtcttatta
ggcgcacatggtgttgggagaagacacataaaaaacactctcatcacaaagcacccagac
cggtttgcgtaccctattccacatacaaccagacctccaaagaaagacgaagaaaatgga
aagaattattactttgtatctcatgaccaaatgatgcaagacatctctaataacgagtac
ttggagtacggcagccacgaggatgcgatgtatgggacaaaactggagaccatccggaag
atccacgagcaggggctgattgcaatactggacgtggagcctcaggcactgaaggtcctg
agaactgcagagtttgctccttttgttgttttcattgctgcaccaactattactccaggt
ttaaatgaggatgaatctcttcagcgtctgcagaaggagtctgacatcttacagagaaca
tatgcacactacttcgatctcacaattatcaacaatgaaattgatgagacaatcagacat
ctggaggaagctgttgagctcgtgtgcacagccccacagtgggtccctgtctcctgggtc
tattag

DBGET integrated database retrieval system