KEGG   Homo sapiens (human): 8576Help
Entry
8576              CDS       T01001                                 

Gene name
STK16, KRCT, MPSK, PKL12, PSK, TSF1, hPSK
Definition
(RefSeq) serine/threonine kinase 16
  KO
K08856  
serine/threonine kinase 16 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     8576 (STK16)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  NAK family [OT]
   8576 (STK16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q35
AA seq 305 aa AA seqDB search
MGHALCVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDRE
EAQREADMHRLFNHPNILRLVAYCLRERGAKHEAWLLLPFFKRGTLWNEIERLKDKGNFL
TEDQILWLLLGICRGLEAIHAKGYAHRDLKPTNILLGDEGQPVLMDLGSMNQACIHVEGS
RQALTLQDWAAQRCTISYRAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYDMVFQ
KGDSVALAVQNQLSIPQSPRHSSALRQLLNSMMTVDPHQRPHIPLLLSQLEALQPPAPGQ
HTTQI
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgggccacgcgctgtgtgtctgctctcggggaactgtcatcattgacaataagcgctac
ctcttcatccagaaactgggggagggtgggttcagctatgtggacctagtggaagggtta
catgatggacacttctacgccctgaagcgaatcctgtgtcacgagcagcaggaccgggag
gaggcccagcgagaagccgacatgcatcgcctcttcaatcaccccaacatccttcgcctc
gtggcttactgtctgagggaacggggtgctaagcatgaggcctggctgctgctaccattc
ttcaagagaggtacgctgtggaatgagatagaaaggctgaaggacaaaggcaacttcctg
accgaggatcaaatcctttggctgctgctggggatctgcagaggccttgaggccattcat
gccaagggttatgcccacagagacttgaagcccaccaatatattgcttggagatgagggg
cagccagttttaatggacttgggttccatgaatcaagcatgcatccatgtggagggctcc
cgccaggctctgaccctgcaggactgggcagcccagcggtgcaccatctcctaccgagcc
ccagagctcttctctgtgcagagtcactgtgtcatcgatgagcggactgatgtctggtcc
ctaggctgcgtgctatatgccatgatgtttggggaaggcccttatgacatggtgttccaa
aagggtgacagtgtggcccttgctgtgcagaaccaactcagcatcccacaaagccccagg
cattcttcagcattgcggcagctcctgaactcgatgatgaccgtggacccgcatcagcgt
cctcacattcctctcctcctcagtcagctggaggcgctgcagcccccagctcctggccaa
catactacccaaatctga

DBGET integrated database retrieval system