KEGG   Homo sapiens (human): 858Help
Entry
858               CDS       T01001                                 

Gene name
CAV2, CAV
Definition
caveolin 2
Orthology
K12958  
caveolin 2
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Focal adhesion
Bacterial invasion of epithelial cells
Proteoglycans in cancer
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Infectious diseases; Bacterial invasion of epithelial cells [PATH:hsa05100]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q31.1
AA seq 149 aa AA seqDB search
MDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEPVTTHSFDKVWICS
HALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVKTCLMVLPSVQTIW
KSVTDVIIAPLCTSVGRCFSSVSLQLSQD
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgactcctacagccaccacagcggcctcgagtacgccgaccccgagaagttc
gcggactcggaccaggaccgggatccccaccggctcaactcgcatctcaagctgggcttc
gaggatgtgatcgcagagccggtgactacgcactcctttgacaaagtgtggatctgcagc
catgccctctttgaaatcagcaaatacgtaatgtacaagttcctgacggtgttcctggcc
attcccctggccttcattgcgggaattctctttgccaccctcagctgtctgcacatctgg
attttaatgccttttgtaaagacctgcctaatggttctgccttcagtgcagacaatatgg
aagagtgtgacagatgttatcattgctccattgtgtacgagcgtaggacgatgcttctct
tctgtcagcctgcaactgagccaggattga

DBGET integrated database retrieval system