KEGG   Homo sapiens (human): 858Help
Entry
858               CDS       T01001                                 

Gene name
CAV2, CAV
Definition
(RefSeq) caveolin 2
  KO
K12958  
caveolin 2
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Focal adhesion
Bacterial invasion of epithelial cells
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    858 (CAV2)
  Cellular community
   04510 Focal adhesion
    858 (CAV2)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    858 (CAV2)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    858 (CAV2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q31.1
AA seq 162 aa AA seqDB search
MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEP
VTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVK
TCLMVLPSVQTIWKSVTDVIIAPLCTSVGRCFSSVSLQLSQD
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggggctggagacggagaaggcggacgtacagctcttcatggacgacgactcctacagc
caccacagcggcctcgagtacgccgaccccgagaagttcgcggactcggaccaggaccgg
gatccccaccggctcaactcgcatctcaagctgggcttcgaggatgtgatcgcagagccg
gtgactacgcactcctttgacaaagtgtggatctgcagccatgccctctttgaaatcagc
aaatacgtaatgtacaagttcctgacggtgttcctggccattcccctggccttcattgcg
ggaattctctttgccaccctcagctgtctgcacatctggattttaatgccttttgtaaag
acctgcctaatggttctgccttcagtgcagacaatatggaagagtgtgacagatgttatc
attgctccattgtgtacgagcgtaggacgatgcttctcttctgtcagcctgcaactgagc
caggattga

DBGET integrated database retrieval system