KEGG   Homo sapiens (human): 859Help
Entry
859               CDS       T01001                                 

Gene name
CAV3, LGMD1C, LQT9, VIP-21, VIP21
Definition
(RefSeq) caveolin 3
  KO
K12959  
caveolin 3
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Focal adhesion
Bacterial invasion of epithelial cells
Proteoglycans in cancer
Disease
H00567  
Caveolinopathies
H00593  
Limb-girdle muscular dystrophy (LGMD)
H00720  
Long QT syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    859 (CAV3)
  Cellular community - eukaryotes
   04510 Focal adhesion
    859 (CAV3)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    859 (CAV3)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    859 (CAV3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    859 (CAV3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p25
AA seq 151 aa AA seqDB search
MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKV
SYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHI
YSLCIRTFCNPLFAALGQVCSSIKVVLRKEV
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgatggcagaagagcacacagatctcgaggcccagatcgtcaaggatatccactgcaag
gagattgacctggtgaaccgagaccccaagaacattaacgaggacatagtcaaggtggat
tttgaagacgtgatcgcagagcctgtgggcacctacagctttgacggcgtgtggaaggtg
agctacaccaccttcactgtctccaagtactggtgctaccgtctgttgtccacgctgctg
ggcgtcccactggccctgctctggggcttcctgttcgcctgcatctccttctgccacatc
tgggcggtggtgccatgcattaagagctacctgatcgagatccagtgcatcagccacatc
tactcactctgcatccgcaccttctgcaacccactcttcgcggccctgggccaggtctgc
agcagcatcaaggtggtgctgcggaaggaggtctaa

DBGET integrated database retrieval system