KEGG   Homo sapiens (human): 8604Help
Entry
8604              CDS       T01001                                 

Gene name
SLC25A12, AGC1, ARALAR
Definition
(RefSeq) solute carrier family 25 member 12
  KO
K15105  
solute carrier family 25 (mitochondrial aspartate/glutamate transporter), member 12/13
Organism
hsa  Homo sapiens (human)
Disease
H01305  
Global cerebral hypomyelination
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   8604 (SLC25A12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q24
AA seq 678 aa AA seqDB search
MAVKVQTTKRGDPHELRNIFLQYASTEVDGERYMTPEDFVQRYLGLYNDPNSNPKIVQLL
AGVADQTKDGLISYQEFLAFESVLCAPDSMFIVAFQLFDKSGNGEVTFENVKEIFGQTII
HHHIPFNWDCEFIRLHFGHNRKKHLNYTEFTQFLQELQLEHARQAFALKDKSKSGMISGL
DFSDIMVTIRSHMLTPFVEENLVSAAGGSISHQVSFSYFNAFNSLLNNMELVRKIYSTLA
GTRKDVEVTKEEFAQSAIRYGQVTPLEIDILYQLADLYNASGRLTLADIERIAPLAEGAL
PYNLAELQRQQSPGLGRPIWLQIAESAYRFTLGSVAGAVGATAVYPIDLVKTRMQNQRGS
GSVVGELMYKNSFDCFKKVLRYEGFFGLYRGLIPQLIGVAPEKAIKLTVNDFVRDKFTRR
DGSVPLPAEVLAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALNVLRDLGIFGL
YKGAKACFLRDIPFSAIYFPVYAHCKLLLADENGHVGGLNLLAAGAMAGVPAASLVTPAD
VIKTRLQVAARAGQTTYSGVIDCFRKILREEGPSAFWKGTAARVFRSSPQFGVTLVTYEL
LQRWFYIDFGGLKPAGSEPTPKSRIADLPPANPDHIGGYRLATATFAGIENKFGLYLPKF
KSPSVAVVQPKAAVAATQ
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcaaggtgcagacaactaagcgaggggatcctcatgagttaagaaacatattt
ctacagtatgccagtactgaggttgatggagagcgttatatgaccccagaagactttgtt
cagcgctatcttggactgtataatgatccaaatagtaacccaaagatcgtgcagctcttg
gcaggagtagctgatcaaaccaaggatgggttgatctcctatcaagagtttttggcattt
gaatctgttttatgtgctccagattccatgttcatagtggctttccagttgtttgacaag
agtggaaatggagaggtgacatttgaaaatgtcaaagaaatttttggacagactattatt
catcatcatatcccttttaactgggattgtgaatttatccgactgcattttgggcataac
cggaagaagcatcttaactacacagaattcacgcagtttctccaggagctgcaattggaa
catgcaagacaagcctttgcactcaaagacaaaagcaaaagtggcatgatttctggtctg
gatttcagtgacatcatggttaccattagatctcacatgcttactccttttgtggaggag
aacttagtttcagcagctggaggaagtatctcacaccaggttagcttctcctacttcaat
gcatttaactcgttactgaataacatggagcttgttcgtaagatatatagcactctagct
ggcacaaggaaagatgttgaagtcacaaaggaggaatttgcccagagtgccatacgctat
ggacaagtcacaccactagaaattgatattctatatcagcttgcagacttatataatgct
tcagggcgcttgactttggcagatattgagagaatagccccattggctgagggggcctta
ccttacaacctggcagaacttcagagacagcagtctcctgggttaggcaggcctatctgg
ctccagattgccgagtctgcttacagattcactctgggctcagttgctggagctgtggga
gccactgcagtgtatcctatagatctggtgaagacccgaatgcaaaaccagcgtggctct
ggctctgttgttggggagctaatgtacaaaaacagctttgactgttttaagaaagtcttg
cgttatgagggcttctttggactctacaggggtctgataccacaacttataggggttgct
ccagaaaaggccattaaactgactgttaatgattttgttcgggacaaatttaccagaaga
gatggctctgttccacttccagcagaagttcttgctggaggctgtgctggaggctctcag
gtcatttttaccaacccattggagatagtgaagattcgtctgcaagtagctggagagatc
accacgggacccagagtcagcgccctgaatgtgctccgggacttgggaatttttggtctg
tataagggtgccaaagcgtgtttcctccgagacattcccttctctgcaatctattttcct
gtttatgctcattgcaaactacttctggctgatgaaaatggacacgtgggaggtttaaat
cttcttgcagctggagccatggcaggtgtcccagctgcatctctggtgacccctgctgat
gtcatcaagacaagactgcaggtggctgcccgcgctggccagacgacatacagtggtgtc
atcgactgtttcaggaagattctccgggaagaagggccctcagcattttggaaagggact
gcagctcgagtgtttcgatcctctccccagtttggtgttaccttggtcacttatgaactt
ctccagcggtggttttacattgattttggaggcctcaaacccgctggttcagaaccaaca
cctaagtcacgcattgcagaccttcctcctgccaaccctgatcacatcggtggatacaga
ctcgccacagccacgtttgcaggcatcgaaaacaaatttggcctttatctcccgaaattt
aagtctcctagtgttgctgtggttcagccaaaggcagcagtggcagccactcagtga

DBGET integrated database retrieval system