KEGG   Homo sapiens (human): 8605Help
Entry
8605              CDS       T01001                                 

Gene name
PLA2G4C, CPLA2-gamma
Definition
phospholipase A2, group IVC (cytosolic, calcium-independent) (EC:3.1.1.4)
Orthology
K16342  
cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
MAPK signaling pathway
Ras signaling pathway
Vascular smooth muscle contraction
VEGF signaling pathway
Fc epsilon RI signaling pathway
Glutamatergic synapse
Serotonergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Ovarian steroidogenesis
Oxytocin signaling pathway
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:hsa00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:hsa00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:hsa00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:hsa00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:hsa00592]
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:hsa04370]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:hsa04664]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:hsa04912]
Organismal Systems; Endocrine system; Ovarian Steroidogenesis [PATH:hsa04913]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:hsa04921]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:hsa04270]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:hsa04724]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
Organismal Systems; Nervous system; Long-term depression [PATH:hsa04730]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:hsa04750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.3
AA seq 551 aa AA seqDB search
MRTRPRPRLRRTENFLTAVHHGKKEEKAAVERRRLHVLKALKKLRIEADEAPVVAVLGSG
GGLRAHIACLGVLSEMKEQGLLDAVTYLAGVSGSTWAISSLYTNDGDMEALEADLKHRFT
RQEWDLAKSLQKTIQAARSENYSLTDFWAYMVISKQTRELPESHLSNMKKPVEEGTLPYP
IFAAIDNDLQPSWQEARAPETWFEFTPHHAGFSALGAFVSITHFGSKFKKGRLVRTHPER
DLTFLRGLWGSALGNTEVIREYIFDQLRNLTLKGLWRRAVANAKSIGHLIFARLLRLQES
SQGEHPPPEDEGGEPEHTWLTEMLENWTRTSLEKQEQPHEDPERKGSLSNLMDFVKKTGI
CASKWEWGTTHNFLYKHGGIRDKIMSSRKHLHLVDAGLAINTPFPLVLPPTREVHLILSF
DFSAGDPFETIRATTDYCRRHKIPFPQVEEAELDLWSKAPASCYILKGETGPVVMHFPLF
NIDACGGDIEAWSDTYDTFKLADTYTLDVVVLLLALAKKNVRENKKKILRELMNVAGLYY
PKDSARSCCLA
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacacgccccagacccaggctcaggaggactgagaattttctgaccgcagtgcac
catgggaagaaagaagaaaaggcggccgtggagagacgaagacttcatgtgctgaaagct
ctgaagaagctaaggattgaggctgatgaggccccagttgttgctgtgctgggctcaggc
ggaggactgcgggctcacattgcctgccttggggtcctgagtgagatgaaagaacagggc
ctgttggatgccgtcacgtacctcgcaggggtctctggatccacttgggcaatatcttct
ctctacaccaatgatggtgacatggaagctctcgaggctgacctgaaacatcgatttacc
cgacaggagtgggacttggctaagagcctacagaaaaccatccaagcagcgaggtctgag
aattactctctgaccgacttctgggcctacatggttatctctaagcaaaccagagaactg
ccggagtctcatttgtccaatatgaagaagcccgtggaagaagggacactaccctaccca
atatttgcagccattgacaatgacctgcaaccttcctggcaggaggcaagagcaccagag
acctggttcgagttcacccctcaccacgctggcttctctgcactgggggcctttgtttcc
ataacccacttcggaagcaaattcaagaagggaagactggtcagaactcaccctgagaga
gacctgactttcctgagaggtttatggggaagtgctcttggtaacactgaagtcattagg
gaatacatttttgaccagttaaggaatctgaccctgaaaggtttatggagaagggctgtt
gctaatgctaaaagcattggacaccttatttttgcccgattactgaggctgcaagaaagt
tcacaaggggaacatcctcccccagaagatgaaggcggtgagcctgaacacacctggctg
actgagatgctcgagaattggaccaggacctccctggaaaagcaggagcagccccatgag
gaccccgaaaggaaaggctcactcagtaacttgatggattttgtgaagaaaacaggcatt
tgcgcttcaaagtgggaatgggggaccactcacaacttcctgtacaaacacggtggcatc
cgggacaagataatgagcagccggaagcacctccacctggtggatgctggtttagccatc
aacactcccttcccactcgtgctgcccccgacgcgggaggttcacctcatcctctccttc
gacttcagtgccggagatcctttcgagaccatccgggctaccactgactactgccgccgc
cacaagatcccctttccccaagtagaagaggctgagctggatttgtggtccaaggccccc
gccagctgctacatcctgaaaggagaaactggaccagtggtgatgcattttcccctgttc
aacatagatgcctgtggaggtgatattgaggcatggagtgacacatacgacacattcaag
cttgctgacacctacactctagatgtggtggtgctactcttggcattagccaagaagaat
gtcagggaaaacaagaagaagatccttagagagttgatgaacgtggccgggctctactac
ccgaaggatagtgcccgaagttgctgcttggcatag

DBGET integrated database retrieval system