KEGG   Homo sapiens (human): 8605Help
Entry
8605              CDS       T01001                                 

Gene name
PLA2G4C, CPLA2-gamma
Definition
(RefSeq) phospholipase A2 group IVC (EC:3.1.1.4)
  KO
K16342  
cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
MAPK signaling pathway
Ras signaling pathway
Phospholipase D signaling pathway
Vascular smooth muscle contraction
VEGF signaling pathway
Platelet activation
Fc epsilon RI signaling pathway
Glutamatergic synapse
Serotonergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Ovarian steroidogenesis
Oxytocin signaling pathway
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    8605 (PLA2G4C)
   00565 Ether lipid metabolism
    8605 (PLA2G4C)
   00590 Arachidonic acid metabolism
    8605 (PLA2G4C)
   00591 Linoleic acid metabolism
    8605 (PLA2G4C)
   00592 alpha-Linolenic acid metabolism
    8605 (PLA2G4C)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    8605 (PLA2G4C)
   04010 MAPK signaling pathway
    8605 (PLA2G4C)
   04370 VEGF signaling pathway
    8605 (PLA2G4C)
   04072 Phospholipase D signaling pathway
    8605 (PLA2G4C)
 Organismal Systems
  Immune system
   04611 Platelet activation
    8605 (PLA2G4C)
   04664 Fc epsilon RI signaling pathway
    8605 (PLA2G4C)
  Endocrine system
   04912 GnRH signaling pathway
    8605 (PLA2G4C)
   04913 Ovarian Steroidogenesis
    8605 (PLA2G4C)
   04921 Oxytocin signaling pathway
    8605 (PLA2G4C)
  Circulatory system
   04270 Vascular smooth muscle contraction
    8605 (PLA2G4C)
  Nervous system
   04724 Glutamatergic synapse
    8605 (PLA2G4C)
   04726 Serotonergic synapse
    8605 (PLA2G4C)
   04730 Long-term depression
    8605 (PLA2G4C)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    8605 (PLA2G4C)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    8605 (PLA2G4C)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     8605 (PLA2G4C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.3
AA seq 541 aa AA seqDB search
MGSSEVSIIPGLQKEEKAAVERRRLHVLKALKKLRIEADEAPVVAVLGSGGGLRAHIACL
GVLSEMKEQGLLDAVTYLAGVSGSTWAISSLYTNDGDMEALEADLKHRFTRQEWDLAKSL
QKTIQAARSENYSLTDFWAYMVISKQTRELPESHLSNMKKPVEEGTLPYPIFAAIDNDLQ
PSWQEARAPETWFEFTPHHAGFSALGAFVSITHFGSKFKKGRLVRTHPERDLTFLRGLWG
SALGNTEVIREYIFDQLRNLTLKGLWRRAVANAKSIGHLIFARLLRLQESSQGEHPPPED
EGGEPEHTWLTEMLENWTRTSLEKQEQPHEDPERKGSLSNLMDFVKKTGICASKWEWGTT
HNFLYKHGGIRDKIMSSRKHLHLVDAGLAINTPFPLVLPPTREVHLILSFDFSAGDPFET
IRATTDYCRRHKIPFPQVEEAELDLWSKAPASCYILKGETGPVVMHFPLFNIDACGGDIE
AWSDTYDTFKLADTYTLDVVVLLLALAKKNVRENKKKILRELMNVAGLYYPKDSARSCCL
A
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgggaagctctgaagtttccataattcctgggctccagaaagaagaaaaggcggccgtg
gagagacgaagacttcatgtgctgaaagctctgaagaagctaaggattgaggctgatgag
gccccagttgttgctgtgctgggctcaggcggaggactgcgggctcacattgcctgcctt
ggggtcctgagtgagatgaaagaacagggcctgttggatgccgtcacgtacctcgcaggg
gtctctggatccacttgggcaatatcttctctctacaccaatgatggtgacatggaagct
ctcgaggctgacctgaaacatcgatttacccgacaggagtgggacttggctaagagccta
cagaaaaccatccaagcagcgaggtctgagaattactctctgaccgacttctgggcctac
atggttatctctaagcaaaccagagaactgccggagtctcatttgtccaatatgaagaag
cccgtggaagaagggacactaccctacccaatatttgcagccattgacaatgacctgcaa
ccttcctggcaggaggcaagagcaccagagacctggttcgagttcacccctcaccacgct
ggcttctctgcactgggggcctttgtttccataacccacttcggaagcaaattcaagaag
ggaagactggtcagaactcaccctgagagagacctgactttcctgagaggtttatgggga
agtgctcttggtaacactgaagtcattagggaatacatttttgaccagttaaggaatctg
accctgaaaggtttatggagaagggctgttgctaatgctaaaagcattggacaccttatt
tttgcccgattactgaggctgcaagaaagttcacaaggggaacatcctcccccagaagat
gaaggcggtgagcctgaacacacctggctgactgagatgctcgagaattggaccaggacc
tccctggaaaagcaggagcagccccatgaggaccccgaaaggaaaggctcactcagtaac
ttgatggattttgtgaagaaaacaggcatttgcgcttcaaagtgggaatgggggaccact
cacaacttcctgtacaaacacggtggcatccgggacaagataatgagcagccggaagcac
ctccacctggtggatgctggtttagccatcaacactcccttcccactcgtgctgcccccg
acgcgggaggttcacctcatcctctccttcgacttcagtgccggagatcctttcgagacc
atccgggctaccactgactactgccgccgccacaagatcccctttccccaagtagaagag
gctgagctggatttgtggtccaaggcccccgccagctgctacatcctgaaaggagaaact
ggaccagtggtgatgcattttcccctgttcaacatagatgcctgtggaggtgatattgag
gcatggagtgacacatacgacacattcaagcttgctgacacctacactctagatgtggtg
gtgctactcttggcattagccaagaagaatgtcagggaaaacaagaagaagatccttaga
gagttgatgaacgtggccgggctctactacccgaaggatagtgcccgaagttgctgcttg
gcatag

DBGET integrated database retrieval system