KEGG   Homo sapiens (human): 8607Help
Entry
8607              CDS       T01001                                 

Gene name
RUVBL1, ECP-54, ECP54, INO80H, NMP_238, NMP238, PONTIN, Pontin52, RVB1, TIH1, TIP49, TIP49A
Definition
(RefSeq) RuvB like AAA ATPase 1 (EC:3.6.4.12)
  KO
K04499  
RuvB-like protein 1 (pontin 52)
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    8607 (RUVBL1)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     8607 (RUVBL1)
  Chromatin remodeling factors
   SRCAP complex
    8607 (RUVBL1)
   INO80 complex
    8607 (RUVBL1)
   INO80 complex (yeast)
    8607 (RUVBL1)
   SWR1 complex
    8607 (RUVBL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q21
AA seq 456 aa AA seqDB search
MKIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKK
MAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAI
GLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESL
QKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTL
HDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGIAELVPGVLF
VDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMI
IRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKIN
GKDSIEKEHVEEISELFYDAKSSAKILADQQDKYMK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgaggaggtgaagagcactacgaagacgcagcgcatcgcctcccacagccac
gtgaaagggctggggctggacgagagcggcttggccaagcaggcggcctcagggcttgtg
ggccaggagaacgcgcgagaggcatgtggcgtcatagtagaattaatcaaaagcaagaaa
atggctggaagagctgtcttgttggcaggacctcctggaactggcaagacagctctggct
ctggctattgctcaggagctgggtagtaaggtccccttctgcccaatggtggggagtgaa
gtttactcaactgagatcaagaagacagaggtgctgatggagaacttccgcagggccatt
gggctgcgaataaaggagaccaaggaagtttatgaaggtgaagtcacagagctaactccg
tgtgagacagagaatcccatgggaggatatggcaaaaccattagccatgtgatcatagga
ctcaaaacagccaaaggaaccaaacagttgaaactggaccccagcatttttgaaagtttg
cagaaagagcgagtagaagctggagatgtgatttacattgaagccaacagtggggccgtg
aagaggcagggcaggtgtgatacctatgccacagaattcgaccttgaagctgaagagtat
gtccccttgccaaaaggggatgtgcacaaaaagaaagaaatcatccaagatgtgaccttg
catgacttggatgtggctaatgcgcggccccaggggggacaagatatcctgtccatgatg
ggccagctaatgaagccaaagaagacagaaatcacagacaaacttcgaggggagattaat
aaggtggtgaacaagtacatcgaccagggcattgctgagctggtcccgggtgtgctgttt
gttgatgaggtccacatgctggacattgagtgcttcacctacctgcaccgcgccctggag
tcttctatcgctcccatcgtcatctttgcatccaaccgaggcaactgtgtcatcagaggc
actgaggacatcacatcccctcacggcatccctcttgaccttctggaccgagtgatgata
atccggaccatgctgtatactccacaggaaatgaaacagatcattaaaatccgtgcccag
acggaaggaatcaacatcagtgaggaggcactgaaccacctgggggagattggcaccaag
accacactgaggtactcagtgcagctgctgaccccggccaacttgcttgctaaaatcaac
gggaaggacagcattgagaaagagcatgtcgaagagatcagtgaacttttctatgatgcc
aagtcctccgccaaaatcctggctgaccagcaggataagtacatgaagtga

DBGET integrated database retrieval system