KEGG   Homo sapiens (human): 8608Help
Entry
8608              CDS       T01001                                 

Gene name
RDH16, RODH-4, SDR9C8
Definition
retinol dehydrogenase 16 (all-trans)
Orthology
K11154  
retinol dehydrogenase 16 [EC:1.1.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Retinol metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:hsa00830]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
UniProt: 
Position
12q13.3
AA seq 317 aa AA seqDB search
MWLYLAVFVGLYYLLHWYRERQVLSHLRDKYVFITGCDSGFGKLLARQLDARGLRVLAAC
LTEKGAEQLRGQTSDRLETVTLDVTKTESVAAAAQWVKECVRDKGLWGLVNNAGISLPTA
PNELLTKQDFVTILDVNLLGVIDVTLSLLPLVRRARGRVVNVSSVMGRVSLFGGGYCISK
YGVEAFSDSLRRELSYFGVKVAMIEPGYFKTAVTSKERFLKSFLEIWDRSSPEVKEAYGE
KFVADYKKSAEQMEQKCTQDLSLVTNCMEHALIACHPRTRYSAGWDAKLLYLPMSYMPTF
LVDAIMYWVSPSPAKAL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtggctctacctggcggttttcgtgggcctgtactaccttctgcactggtaccgggag
aggcaggtgctgagccacctgagagataagtatgtgttcatcacgggctgtgactctggc
ttcgggaaactgctggccagacagctggatgcacgaggcttgcgggtgctggctgcatgt
ctgacggagaaaggagccgagcagctgaggggccagacttcagacaggctggagacggtg
accctggatgttaccaagacagagagcgttgctgcagccgcccagtgggtgaaggagtgc
gtgagagacaaaggactctggggcctggtgaataatgctggcatctccttgcccacggct
cccaatgagttgctcaccaagcaggacttcgtgaccatactggacgtgaacttgttgggg
gtgattgatgtgactctgagcctgctgcccttagtgaggagggccaggggccgtgtggtc
aacgtctccagtgtcatgggccgggtgtcactttttggtggaggctactgcatctccaag
tatggcgtggaagccttctctgactccctcaggagggaactctcctactttggggtgaag
gtggctatgattgaacctggctatttcaagactgctgtgaccagtaaggagagattctta
aagagcttcctggagatttgggaccggtccagtccagaggtcaaggaggcctatggcgag
aagtttgttgcagactataagaaatcagctgaacaaatggagcagaagtgcacacaggat
ctgtcgttggtgaccaactgcatggagcatgcgctgattgcctgccacccccgtactcgc
tactcagctggctgggatgccaagcttctctacctccccatgagctacatgcccaccttc
ctggtggatgccattatgtactgggtctctccaagcccggccaaggctctatga

DBGET integrated database retrieval system