KEGG   Homo sapiens (human): 861Help
Entry
861               CDS       T01001                                 

Gene name
RUNX1, AML1, AML1-EVI-1, AMLCR1, CBF2alpha, CBFA2, EVI-1, PEBP2aB, PEBP2alpha
Definition
(RefSeq) runt related transcription factor 1
  KO
K08367  
runt-related transcription factor 1
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Th17 cell differentiation
Pathways in cancer
Transcriptional misregulation in cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Disease
H00001  
B lymphoblastic leukemia/lymphoma
H00003  
Acute myeloid leukemia (AML)
H00004  
Chronic myeloid leukemia (CML)
H00978  
Thrombocytopenia (THC)
H01481  
Myelodysplastic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    861 (RUNX1)
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    861 (RUNX1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    861 (RUNX1)
   05202 Transcriptional misregulation in cancers
    861 (RUNX1)
   05221 Acute myeloid leukemia
    861 (RUNX1)
   05220 Chronic myeloid leukemia
    861 (RUNX1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   Runt
    861 (RUNX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q01196(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
21q22.12
AA seq 453 aa AA seqDB search
MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDRSMVEVLADHPG
ELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNA
TAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHR
QKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQM
QDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDL
TAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGIGIGMSAMGSATRYHTYLPPPYPG
SSQAQGGPFQASSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTNASTGSALLNPSLP
NQSDVVEAEGSHSNSPTNMAPSARLEEAVWRPY
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatccccgtagatgccagcacgagccgccgcttcacgccgccttccaccgcgctg
agcccaggcaagatgagcgaggcgttgccgctgggcgccccggacgccggcgctgccctg
gccggcaagctgaggagcggcgaccgcagcatggtggaggtgctggccgaccacccgggc
gagctggtgcgcaccgacagccccaacttcctctgctccgtgctgcctacgcactggcgc
tgcaacaagaccctgcccatcgctttcaaggtggtggccctaggggatgttccagatggc
actctggtcactgtgatggctggcaatgatgaaaactactcggctgagctgagaaatgct
accgcagccatgaagaaccaggttgcaagatttaatgacctcaggtttgtcggtcgaagt
ggaagagggaaaagcttcactctgaccatcactgtcttcacaaacccaccgcaagtcgcc
acctaccacagagccatcaaaatcacagtggatgggccccgagaacctcgaagacatcgg
cagaaactagatgatcagaccaagcccgggagcttgtccttttccgagcggctcagtgaa
ctggagcagctgcggcgcacagccatgagggtcagcccacaccacccagcccccacgccc
aaccctcgtgcctccctgaaccactccactgcctttaaccctcagcctcagagtcagatg
caggatacaaggcagatccaaccatccccaccgtggtcctacgatcagtcctaccaatac
ctgggatccattgcctctccttctgtgcacccagcaacgcccatttcacctggacgtgcc
agcggcatgacaaccctctctgcagaactttccagtcgactctcaacggcacccgacctg
acagcgttcagcgacccgcgccagttccccgcgctgccctccatctccgacccccgcatg
cactatccaggcgccttcacctactccccgacgccggtcacctcgggcatcggcatcggc
atgtcggccatgggctcggccacgcgctaccacacctacctgccgccgccctaccccggc
tcgtcgcaagcgcagggaggcccgttccaagccagctcgccctcctaccacctgtactac
ggcgcctcggccggctcctaccagttctccatggtgggcggcgagcgctcgccgccgcgc
atcctgccgccctgcaccaacgcctccaccggctccgcgctgctcaaccccagcctcccg
aaccagagcgacgtggtggaggccgagggcagccacagcaactcccccaccaacatggcg
ccctccgcgcgcctggaggaggccgtgtggaggccctactga

DBGET integrated database retrieval system