KEGG   Homo sapiens (human): 8611Help
Entry
8611              CDS       T01001                                 

Gene name
PLPP1, LLP1a, LPP1, PAP-2a, PAP2, PPAP2A
Definition
(RefSeq) phospholipid phosphatase 1
  KO
K01080  phosphatidate phosphatase [EC:3.1.3.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04072  Phospholipase D signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04975  Fat digestion and absorption
hsa05231  Choline metabolism in cancer
Module
hsa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    8611 (PLPP1)
   00564 Glycerophospholipid metabolism
    8611 (PLPP1)
   00565 Ether lipid metabolism
    8611 (PLPP1)
   00600 Sphingolipid metabolism
    8611 (PLPP1)
 Environmental Information Processing
  Signal transduction
   04072 Phospholipase D signaling pathway
    8611 (PLPP1)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    8611 (PLPP1)
  Digestive system
   04975 Fat digestion and absorption
    8611 (PLPP1)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    8611 (PLPP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     8611 (PLPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP2 PAP2_C COX4 PAP2_3 TPPK_C
Motif
Other DBs
NCBI-GeneID: 8611
NCBI-ProteinID: NP_003702
OMIM: 607124
HGNC: 9228
Ensembl: ENSG00000067113
Vega: OTTHUMG00000162240
Pharos: O14494(Tbio)
UniProt: O14494 A0A024QZS3
Position
5q11.2
AA seq 284 aa AA seqDB search
MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLG
GIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAK
YSIGRLRPHFLDVCDPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCML
FVALYLQARMKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAI
LVAVYVSDFFKERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgtttgacaagacgcggctgccgtacgtggccctcgatgtgctctgcgtgttgctggct
ggattgccttttgcaattcttacttcaaggcatacccccttccaacgaggagtattctgt
aatgatgagtccatcaagtacccttacaaagaagacaccataccttatgcgttattaggt
ggaataatcattccattcagtattatcgttattattcttggagaaaccctgtctgtttac
tgtaaccttttgcactcaaattcctttatcaggaataactacatagccactatttacaaa
gccattggaacctttttatttggtgcagctgctagtcagtccctgactgacattgccaag
tattcaataggcagactgcggcctcacttcttggatgtttgtgatccagattggtcaaaa
atcaactgcagcgatggttacattgaatactacatatgtcgagggaatgcagaaagagtt
aaggaaggcaggttgtccttctattcaggccactcttcgttttccatgtactgcatgctg
tttgtggcactttatcttcaagccaggatgaagggagactgggcaagactcttacgcccc
acactgcaatttggtcttgttgccgtatccatttatgtgggcctttctcgagtttctgat
tataaacaccactggagcgatgtgttgactggactcattcagggagctctggttgcaata
ttagttgctgtatatgtatcggatttcttcaaagaaagaacttcttttaaagaaagaaaa
gaggaggactctcatacaactctgcatgaaacaccaacaactgggaatcactatccgagc
aatcaccagccttga

DBGET integrated database retrieval system