KEGG   Homo sapiens (human): 8612Help
Entry
8612              CDS       T01001                                 

Gene name
PPAP2C, LPP2, PAP-2c, PAP2-g
Definition
phosphatidic acid phosphatase type 2C (EC:3.1.3.4)
Orthology
K01080  
phosphatidate phosphatase [EC:3.1.3.4]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Ether lipid metabolism
Sphingolipid metabolism
Metabolic pathways
Fc gamma R-mediated phagocytosis
Fat digestion and absorption
Module
Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    8612 (PPAP2C)
   00564 Glycerophospholipid metabolism
    8612 (PPAP2C)
   00565 Ether lipid metabolism
    8612 (PPAP2C)
   00600 Sphingolipid metabolism
    8612 (PPAP2C)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    8612 (PPAP2C)
  Digestive system
   04975 Fat digestion and absorption
    8612 (PPAP2C)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     8612 (PPAP2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13
AA seq 288 aa AA seqDB search
MQRRWVFVLLDVLCLLVASLPFAILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGV
TITATVILVSAGEAYLVYTDRLYSRSDFNNYVAAVYKVLGTFLFGAAVSQSLTDLAKYMI
GRLRPNFLAVCDPDWSRVNCSVYVQLEKVCRGNPADVTEARLSFYSGHSSFGMYCMVFLA
LYVQARLCWKWARLLRPTVQFFLVAFALYVGYTRVSDYKHHWSDVLVGLLQGALVAALTV
CYISDFFKARPPQHCLKEEELERKPSLSLTLTLGEADHNHYGYPHSSS
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggaggtgggtcttcgtgctgctcgacgtgctgtgcttactggtcgcctccctg
cccttcgctatcctgacgctggtgaacgccccgtacaagcgaggattttactgcggggat
gactccatccggtacccctaccgtccagataccatcacccacgggctcatggctggggtc
accatcacggccaccgtcatccttgtctcggccggggaagcctacctggtgtacacagac
cggctctattctcgctcggacttcaacaactacgtggctgctgtatacaaggtgctgggg
accttcctgtttggggctgccgtgagccagtctctgacagacctggccaagtacatgatt
gggcgtctgaggcccaacttcctagccgtctgcgaccccgactggagccgggtcaactgc
tcggtctatgtgcagctggagaaggtgtgcaggggaaaccctgctgatgtcaccgaggcc
aggttgtctttctactcgggacactcttcctttgggatgtactgcatggtgttcttggcg
ctgtatgtgcaggcacgactctgttggaagtgggcacggctgctgcgacccacagtccag
ttcttcctggtggcctttgccctctacgtgggctacacccgcgtgtctgattacaaacac
cactggagcgatgtccttgttggcctcctgcagggggcactggtggctgccctcactgtc
tgctacatctcagacttcttcaaagcccgacccccacagcactgtctgaaggaggaggag
ctggaacggaagcccagcctgtcactgacgttgaccctgggcgaggctgaccacaaccac
tatggatacccgcactcctcctcctga

DBGET integrated database retrieval system