KEGG   Homo sapiens (human): 8615Help
Entry
8615              CDS       T01001                                 

Gene name
USO1, P115, TAP, VDP
Definition
(RefSeq) USO1 vesicle transport factor
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q21.1
AA seq 962 aa AA seqDB search
MNFLRGVMGGQSAGPQHTEAETIQKLCDRVASSTLLDDRRNAVRALKSLSKKYRLEVGIQ
AMEHLIHVLQTDRSDSEIIGYALDTLYNIISNEEEEEVEENSTRQSEDLGSQFTEIFIKQ
QENVTLLLSLLEEFDFHVRWPGVKLLTSLLKQLGPQVQQIILVSPMGVSRLMDLLADSRE
VIRNDGVLLLQALTRSNGAIQKIVAFENAFERLLDIISEEGNSDGGIVVEDCLILLQNLL
KNNNSNQNFFKEGSYIQRMKPWFEVGDENSGWSAQKVTNLHLMLQLVRVLVSPTNPPGAT
SSCQKAMFQCGLLQQLCTILMATGVPADILTETINTVSEVIRGCQVNQDYFASVNAPSNP
PRPAIVVLLMSMVNERQPFVLRCAVLYCFQCFLYKNQKGQGEIVSTLLPSTIDATGNSVS
AGQLLCGGLFSTDSLSNWCAAVALAHALQENATQKEQLLRVQLATSIGNPPVSLLQQCTN
ILSQGSKIQTRVGLLMLLCTWLSNCPIAVTHFLHNSANVPFLTGQIAENLGEEEQLVQGL
CALLLGISIYFNDNSLESYMKEKLKQLIEKRIGKENFIEKLGFISKHELYSRASQKPQPN
FPSPEYMIFDHEFTKLVKELEGVITKAIYKSSEEDKKEEEVKKTLEQHDNIVTHYKNMIR
EQDLQLEELRQQVSTLKCQNEQLQTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSE
GAQMNGIQPEEIGRLREEIEELKRNQELLQSQLTEKDSMIENMKSSQTSGTNEQSSAIVS
ARDSEQVAELKQELATLKSQLNSQSVEITKLQTEKQELLQKTEAFAKSVEVQGETETIIA
TKTTDVEGRLSALLQETKELKNEIKALSEERTAIKEQLDSSNSTIAILQTEKDKLELEIT
DSKKEQDDLLVLLADQDQKILSLKNKLKDLGHPVEEEDELESGDQEDEDDESEDPGKDLD
HI
NT seq 2889 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcctccgcggggtaatggggggtcagagtgccggaccccagcacacagaagcc
gagacgattcaaaagctttgtgacagagtagcttcatctactttattggatgatcgaaga
aatgctgttcgtgctctcaaatcattatctaagaaataccgcttggaagtgggtatacaa
gctatggaacatcttattcatgttttacaaacagatcgttcagattctgaaataataggt
tatgctttggacacactatataatataatatctaatgaagaagaagaagaagtagaagaa
aattccacaagacagagtgaagatttgggaagccaatttacagaaattttcattaagcag
caggaaaatgtcactcttctgttatctttattggaggagtttgatttccatgtccgctgg
cctggtgtgaagcttcttacttctcttttaaaacaactagggcctcaggtgcaacaaatt
attttagtcagtcctatgggtgtttcaagattgatggacttactagcggattccagggaa
gttatacgtaatgatggcgtcttactactgcaggcactaacaagaagcaatggtgcaatc
cagaaaattgttgcttttgaaaatgctttcgagagactactggacattatttcagaggag
gggaacagtgatggaggtatagtagttgaagattgtttgattttgctccaaaacttatta
aaaaacaacaactccaatcaaaatttttttaaagaaggctcatatattcaacgtatgaaa
ccttggtttgaagttggagatgaaaattctggctggtctgcacagaaagtgaccaatcta
catctaatgctacagcttgttcgtgtattggtatctcccaccaaccctcctggtgctacc
agtagctgccagaaggctatgttccagtgtgggttattgcagcagctttgtactatccta
atggctactggggttcctgctgatatcctgactgagaccataaatactgtatcagaagtt
attcgaggctgccaagtaaaccaagactactttgcatctgtaaatgcaccttcaaaccca
ccaagaccggcaattgtagtacttctcatgtccatggttaatgaaaggcagccatttgtt
ttgcgctgtgctgttctctattgtttccagtgtttcttgtataaaaaccaaaaaggacaa
ggagaaatcgtgtcaacacttttaccttctaccattgatgcaacaggtaattcagtttca
gctggccagttattatgtggaggtttgttttctactgattcactttcaaactggtgtgct
gctgtggcccttgcccatgcgttgcaagaaaatgccacccagaaagaacagttgctcagg
gttcaacttgctacaagtattggcaaccctccagtttctttacttcaacagtgcaccaat
attctttcacagggaagcaaaatacaaacaagagttggattattaatgttgctttgtacc
tggctaagcaattgtcccattgcagtaacgcattttcttcacaattcagccaatgttcca
tttcttacaggacaaattgcagaaaatcttggagaagaagagcagttggtccaaggctta
tgtgcccttttgttgggcatttcgatttatttcaatgataactcacttgagagctacatg
aaagagaagctaaaacaactgattgagaagaggattggcaaagagaatttcatagagaaa
ctaggatttattagcaaacatgagttgtattccagagcatctcagaaaccccagccaaac
tttcccagtccagaatacatgatatttgatcatgagtttacgaagctggtaaaagaactt
gaaggtgttataactaaggctatttataagtccagtgaagaagataaaaaagaagaagag
gtgaaaaaaacattagaacagcatgacaatattgtgactcactacaaaaatatgattcga
gagcaggatctccaacttgaggaattaaggcagcaggtttctacattaaaatgtcaaaat
gaacagctccagacggcagtcacacagcaagtatcacagatccagcagcacaaagaccag
tataatcttcttaaaatacagctaggaaaagacaatcagcatcaaggttcttacagtgag
ggggctcagatgaatggcattcagccagaagaaattggtagattgcgagaagagatagaa
gaattaaaacgtaatcaggaacttttacaaagccagctgactgaaaaggactctatgatt
gaaaatatgaaatcttcccaaacatctggcacaaatgaacagtcttcagcaatagtttca
gctagagattctgaacaagttgcagaattaaaacaggaactggcaactttaaagtctcag
ttaaactcacaatctgtggagatcaccaaactacagacagaaaagcaggaactgttacag
aaaacagaagcgtttgcaaaatcagttgaggtacaaggagagaccgagactataatagcc
accaaaactactgatgtagaaggaagactgtcagcattattacaagagaccaaagagtta
aagaatgaaattaaagctctgtctgaggaaagaactgccattaaagagcagctggattca
tctaatagtaccattgccattttacaaactgagaaagacaaactagagttggaaattaca
gattctaaaaaagaacaagatgatctcttggtgctcttggccgatcaagatcagaaaata
ctgtcattgaagaataaactcaaggatcttggtcatccagttgaagaagaggatgaactt
gaatctggagaccaagaggatgaggatgatgaaagtgaagatcctggcaaggatctagat
catatctag

DBGET integrated database retrieval system