KEGG   Homo sapiens (human): 862Help
Entry
862               CDS       T01001                                 

Gene name
RUNX1T1, AML1T1, CBFA2T1, CDR, ETO, MTG8, ZMYND2
Definition
runt-related transcription factor 1; translocated to, 1 (cyclin D-related)
Orthology
K10053  
runt-related transcription factor 1; translocated to, 1
Organism
hsa  Homo sapiens (human)
Pathway
Pathways in cancer
Transcriptional misregulation in cancer
Acute myeloid leukemia
Disease
H00003  
Acute myeloid leukemia (AML)
Class
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Cancers; Acute myeloid leukemia [PATH:hsa05221]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q22
AA seq 577 aa AA seqDB search
MPDRTEKHSTMPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTAL
NGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGER
VRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNP
AQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLHSEHPSKRP
CTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRN
RPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADRE
ELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWK
KAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQ
QEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAQQQGDTPAVS
SSVTPNSGAGSPMDTPPAATPRSTTPGTPSTIETTPR
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatcgtactgagaagcactccacaatgccagactcacctgtggatgtgaagacg
caatctaggctgactcctccaacaatgccacctcccccaactactcaaggagctccaaga
accagttcatttacaccgacaacgttaactaatggcacgagccattctcctacagccttg
aatggcgccccctcaccacccaatggcttcagcaatgggccttcctcttcttcctcctcc
tctctggctaatcaacagctgcccccagcctgtggtgccaggcaactcagcaagctgaaa
aggttccttactaccctgcagcagtttggcaatgacatttcacccgagataggagaaaga
gttcgcaccctcgttctgggactagtgaactccactttgacaattgaagaatttcattcc
aaactgcaagaagctactaacttcccactgagaccttttgtcatcccatttttgaaggcc
aacttgcccctgctgcagcgtgagctcctccactgcgcaagactggccaaacagaaccct
gcccagtacctcgcccagcatgaacagctgcttctggatgccagcaccacctcacctgtt
gactcctcagagctgcttctcgatgtgaacgaaaacgggaagaggcgaactccagacaga
accaaagaaaatggctttgacagagagcctttgcactcagaacatccaagcaagcgacca
tgcactattagcccaggccagcggtacagtccaaataacggcttatcctaccagcccaat
ggcctgcctcaccctaccccacctccacctcagcattaccgtttggatgatatggccatt
gcccaccactacagggactcctatcgacaccccagccacagggacctcagggacagaaac
agacctatggggttgcatggcacacgtcaagaagaaatgattgatcacagactaacagac
agagaatgggcagaagagtggaaacatcttgaccatctgttaaactgcataatggacatg
gtagaaaaaacaaggcgatctctcaccgtactaaggcggtgtcaagaagcagaccgggaa
gaattgaattactggatccggcggtacagtgacgccgaggacttaaaaaaaggtggcggc
agtagcagcagccactctaggcagcagagtcccgtcaacccagacccagttgcactagac
gcgcatcgggaattccttcacaggcctgcgtctggatacgtgccagaggagatctggaag
aaagctgaggaggccgtcaatgaggtgaagcgccaggcgatgacggagctgcagaaggcc
gtgtctgaggcggagcggaaagcccacgacatgatcacaacagagagggccaagatggag
cgcacggtcgccgaggccaaacggcaggcggcggaggacgcactggcagttatcaatcag
caggaggattcaagcgagagttgctggaattgtggccgtaaagcgagtgaaacctgcagt
ggctgtaacacagcccgatactgtggctcattttgccagcacaaagactgggagaagcac
catcacatctgtggacagaccctgcaggcccagcagcagggagacacacctgcagtcagc
tcctctgtcacgcccaacagcggggctgggagcccgatggacacaccaccagcagccact
ccgaggtcaaccaccccgggaaccccttccaccatagagacaacccctcgctag

DBGET integrated database retrieval system