KEGG   Homo sapiens (human): 862Help
Entry
862               CDS       T01001                                 

Gene name
RUNX1T1, AML1-MTG8, AML1T1, CBFA2T1, CDR, ETO, MTG8, ZMYND2
Definition
(RefSeq) RUNX1 translocation partner 1
  KO
K10053  
runt-related transcription factor 1; translocated to, 1
Organism
hsa  Homo sapiens (human)
Pathway
Pathways in cancer
Transcriptional misregulation in cancer
Acute myeloid leukemia
Disease
H00003  
Acute myeloid leukemia (AML)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    862 (RUNX1T1)
   05202 Transcriptional misregulation in cancers
    862 (RUNX1T1)
   05221 Acute myeloid leukemia
    862 (RUNX1T1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q22
AA seq 604 aa AA seqDB search
MISVKRNTWRALSLVIGDCRKKGNFEYCQDRTEKHSTMPDSPVDVKTQSRLTPPTMPPPP
TTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGA
RQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPF
VIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENG
KRRTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHY
RLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHL
LNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVN
PDPVALDAHREFLHRPASGYVPEEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMIT
TERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQ
HKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPSTIE
TTPR
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgatatctgtcaaaagaaacacttggagagcactgagtttagtaataggtgactgccgg
aaaaaagggaactttgaatattgtcaagatcgtactgagaagcactccacaatgccagac
tcacctgtggatgtgaagacgcaatctaggctgactcctccaacaatgccacctccccca
actactcaaggagctccaagaaccagttcatttacaccgacaacgttaactaatggcacg
agccattctcctacagccttgaatggcgccccctcaccacccaatggcttcagcaatggg
ccttcctcttcttcctcctcctctctggctaatcaacagctgcccccagcctgtggtgcc
aggcaactcagcaagctgaaaaggttccttactaccctgcagcagtttggcaatgacatt
tcacccgagataggagaaagagttcgcaccctcgttctgggactagtgaactccactttg
acaattgaagaatttcattccaaactgcaagaagctactaacttcccactgagacctttt
gtcatcccatttttgaaggccaacttgcccctgctgcagcgtgagctcctccactgcgca
agactggccaaacagaaccctgcccagtacctcgcccagcatgaacagctgcttctggat
gccagcaccacctcacctgttgactcctcagagctgcttctcgatgtgaacgaaaacggg
aagaggcgaactccagacagaaccaaagaaaatggctttgacagagagcctttgcactca
gaacatccaagcaagcgaccatgcactattagcccaggccagcggtacagtccaaataac
ggcttatcctaccagcccaatggcctgcctcaccctaccccacctccacctcagcattac
cgtttggatgatatggccattgcccaccactacagggactcctatcgacaccccagccac
agggacctcagggacagaaacagacctatggggttgcatggcacacgtcaagaagaaatg
attgatcacagactaacagacagagaatgggcagaagagtggaaacatcttgaccatctg
ttaaactgcataatggacatggtagaaaaaacaaggcgatctctcaccgtactaaggcgg
tgtcaagaagcagaccgggaagaattgaattactggatccggcggtacagtgacgccgag
gacttaaaaaaaggtggcggcagtagcagcagccactctaggcagcagagtcccgtcaac
ccagacccagttgcactagacgcgcatcgggaattccttcacaggcctgcgtctggatac
gtgccagaggagatctggaagaaagctgaggaggccgtcaatgaggtgaagcgccaggcg
atgacggagctgcagaaggccgtgtctgaggcggagcggaaagcccacgacatgatcaca
acagagagggccaagatggagcgcacggtcgccgaggccaaacggcaggcggcggaggac
gcactggcagttatcaatcagcaggaggattcaagcgagagttgctggaattgtggccgt
aaagcgagtgaaacctgcagtggctgtaacacagcccgatactgtggctcattttgccag
cacaaagactgggagaagcaccatcacatctgtggacagaccctgcaggcccagcagcag
ggagacacacctgcagtcagctcctctgtcacgcccaacagcggggctgggagcccgatg
gacacaccaccagcagccactccgaggtcaaccaccccgggaaccccttccaccatagag
acaacccctcgctag

DBGET integrated database retrieval system