KEGG   Homo sapiens (human): 8621Help
Entry
8621              CDS       T01001                                 

Gene name
CDK13, CDC2L, CDC2L5, CHED, hCDK13
Definition
(RefSeq) cyclin-dependent kinase 13 (EC:2.7.11.23 2.7.11.22)
  KO
K08819  
cyclin-dependent kinase 12/13 [EC:2.7.11.22 2.7.11.23]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     8621 (CDK13)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     8621 (CDK13)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   8621 (CDK13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7p13
AA seq 1512 aa AA seqDB search
MPSSSDTALGGGGGLSWAEKKLEERRKRRRFLSPQQPPLLLPLLQPQLLQPPPPPPPLLF
LAAPGTAAAAAAAAAASSSCFSPGPPLEVKRLARGKRRAGGRQKRRRGPRAGQEAEKRRV
FSLPQPQQDGGGGASSGGGVTPLVEYEDVSSQSEQGLLLGGASAATAATAAGGTGGSGGS
PASSSGTQRRGEGSERRPRRDRRSSSGRSKERHREHRRRDGQRGGSEASKSRSRHSHSGE
ERAEVAKSGSSSSSGGRRKSASATSSSSSSRKDRDSKAHRSRTKSSKEPPSAYKEPPKAY
REDKTEPKAYRRRRSLSPLGGRDDSPVSHRASQSLRSRKSPSPAGGGSSPYSRRLPRSPS
PYSRRRSPSYSRHSSYERGGDVSPSPYSSSSWRRSRSPYSPVLRRSGKSRSRSPYSSRHS
RSRSRHRLSRSRSRHSSISPSTLTLKSSLAAELNKNKKARAAEAARAAEAAKAAEATKAA
EAAAKAAKASNTSTPTKGNTETSASASQTNHVKDVKKIKIEHAPSPSSGGTLKNDKAKTK
PPLQVTKVENNLIVDKATKKAVIVGKESKSAATKEESVSLKEKTKPLTPSIGAKEKEQHV
ALVTSTLPPLPLPPMLPEDKEADSLRGNISVKAVKKEVEKKLRCLLADLPLPPELPGGDD
LSKSPEEKKTATQLHSKRRPKICGPRYGETKEKDIDWGKRCVDKFDIIGIIGEGTYGQVY
KARDKDTGEMVALKKVRLDNEKEGFPITAIREIKILRQLTHQSIINMKEIVTDKEDALDF
KKDKGAFYLVFEYMDHDLMGLLESGLVHFNENHIKSFMRQLMEGLDYCHKKNFLHRDIKC
SNILLNNRGQIKLADFGLARLYSSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSC
GCILGELFTKKPIFQANQELAQLELISRICGSPCPAVWPDVIKLPYFNTMKPKKQYRRKL
REEFVFIPAAALDLFDYMLALDPSKRCTAEQALQCEFLRDVEPSKMPPPDLPLWQDCHEL
WSKKRRRQKQMGMTDDVSTIKAPRKDLSLGLDDSRTNTPQGVLPSSQLKSQGSSNVAPVK
TGPGQHLNHSELAILLNLLQSKTSVNMADFVQVLNIKVNSETQQQLNKINLPAGILATGE
KQTDPSTPQQESSKPLGGIQPSSQTIQPKVETDAAQAAVQSAFAVLLTQLIKAQQSKQKD
VLLEERENGSGHEASLQLRPPPEPSTPVSGQDDLIQHQDMRILELTPEPDRPRILPPDQR
PPEPPEPPPVTEEDLDYRTENQHVPTTSSSLTDPHAGVKAALLQLLAQHQPQDDPKREGG
IDYQAGDTYVSTSDYKDNFGSSSFSSAPYVSNDGLGSSSAPPLERRSFIGNSDIQSLDNY
STASSHSGGPPQPSAFSESFPSSVAGYGDIYLNAGPMLFSGDKDHRFEYSHGPIAVLANS
SDPSTGPESTHPLPAKMHNYNYGGNLQENPSGPSLMHGQTWTSPAQGPGYSQGYRGHIST
STGRGRGRGLPY
NT seq 4539 nt NT seq  +upstreamnt  +downstreamnt
atgccgagcagctcggacacggcgctggggggaggcgggggcctgagctgggcggagaag
aagttggaggaacgccgcaagcggaggcgattcctgtcccctcagcagccgccgctgctg
ttgccgctcctgcagccgcagctcctgcaaccgccgccgcccccgccgcctctgctcttc
ctggctgctcccggcacggccgccgccgcagccgccgccgccgcggcctcctcctcttgc
ttcagcccgggcccccctctggaggtcaagcggctggcgagaggcaagaggcgcgcagga
gggcggcagaagcggcgtcgcgggccccgcgccgggcaggaggcggagaagcgtcgggtc
ttctcgctgccccagccgcagcaggacggcggtggcggtgctagtagcggcgggggtgtg
accccgctggtggaatacgaggatgtgagctcccagtccgagcaggggctgctgctgggg
ggggccagcgcggcaacggcggcgacggctgccgggggaacggggggcagcggcgggagt
ccggcctcctcctccggcacccagcggcgcggggaggggtcggagcgcaggccccgccgg
gaccgccgcagcagcagtggccgcagcaaggagcgccaccgcgagcaccggcggcgggat
gggcagcgcggtggcagcgaggcctccaagtcccgcagccgccacagccacagcggcgag
gaacgggccgaggtcgccaagagcggcagcagcagcagcagcggcggccgccggaaaagc
gcttcggccacatccagcagcagtagcagccgcaaggaccgggactcgaaggcccaccgc
agccggactaagtcgtccaaggagccgccttcggcctacaaggaaccgcccaaggcctac
cgggaggacaagaccgagcctaaggcctacaggcggcggcggtccctcagcccactggga
ggccgggacgacagcccggtgtcccacagggcctctcagagcctgaggagccgcaagtcc
cccagcccggcaggaggtggcagcagcccctattctcggcggctgccgcgctccccgagc
ccctacagtcgccgccgctcccccagctacagccgccacagctcctacgagcggggcggc
gacgtgtcccctagtccctacagcagcagcagctggcgccgctctcgcagtccctacagc
cctgtgctcagacggtctggaaaatcccgaagcagaagcccgtattcatctaggcattca
agatctcgtagcaggcacagattgtctagatccagaagtcgtcattctagtatttctcct
agcacactaactctgaagagtagcctggcagctgaattgaacaagaataaaaaagcacga
gcagcagaggcagcaagagccgcagaagcagcgaaagctgcagaagcaactaaggctgct
gaggctgctgccaaggctgcaaaagcttcaaacacttctacacctaccaaggggaacacg
gaaactagtgccagtgcatcacaaacaaaccatgtgaaggatgtgaagaaaattaaaatt
gaacatgcaccttctccctcaagtggtggaactttaaaaaatgacaaagcaaaaacaaag
ccacctcttcaggtaacgaaggtggaaaataatttgattgtagataaagccaccaagaaa
gcagtcatagttggaaaggagagtaaatctgctgctacaaaggaggaatcagtatctctt
aaagagaaaaccaaaccacttacaccaagcataggagccaaggagaaggagcaacatgta
gctttagtcacctctacattaccaccgttacctttgcctcccatgctgcctgaagataaa
gaagctgatagcttacgaggaaatatttcagtaaaagcagttaaaaaagaagtagaaaag
aaactccgatgtcttcttgctgatttaccgctgccccctgagctaccaggaggagatgat
ctttcaaagagtccagaggaaaagaaaacagcaacacagttacatagtaaaaggaggcct
aaaatatgtgggcctcgctatggtgaaaccaaagaaaaagatattgactggggaaaacgc
tgcgtggataaatttgatatcatcggaattattggagaaggtacttacggacaagtttac
aaagccagggataaagacactggagaaatggtagccttaaaaaaagtacgtctggataat
gaaaaggaaggctttccaattacagcaattcgagaaattaaaattctccggcagcttacc
catcagagtattatcaatatgaaggaaatagtgactgataaagaagatgctttggatttc
aagaaggacaaaggtgcattttatctggtgtttgaatatatggaccatgatctgatggga
ctactggaatcaggcttggttcattttaatgaaaatcacataaagtcatttatgagacag
ctcatggagggtctggattattgtcataagaagaactttttgcatagagatattaaatgt
tccaatatccttctaaataatagagggcagataaaacttgcagactttggacttgctcga
ttgtatagctcagaagaaagtcggccgtatactaacaaggtaattactttatggtaccgt
ccacctgaactgctactgggagaagaacgatacacaccagccattgatgtatggagctgt
ggctgtatccttggcgaactcttcactaaaaaacctatatttcaagcaaatcaggaactt
gcacaactagaattaataagccgaatatgtgggagtccatgtcctgcagtgtggcctgat
gtaatcaaactaccatatttcaacaccatgaaaccaaagaagcaatatcgtcgaaagtta
agagaagaatttgtttttattcctgcagctgcgctagacttatttgattacatgcttgcc
ttggatcctagtaagcgctgcactgctgaacaggctcttcagtgcgagttcctccgagat
gtggaaccctcaaaaatgcctccaccagatctccctttatggcaagattgtcatgagtta
tggagtaaaaagcgaagaagacagaagcagatgggcatgactgatgatgtttccacaatt
aaagcccccaggaaggacttgtctctgggcttggatgacagcagaaccaacacaccccag
ggtgtgctgccatcttcacagctgaaatctcagggcagctcaaatgtggcacctgtaaaa
acaggccctggacagcacttaaaccacagtgaattggcaattctactaaacctactacaa
tctaaaacaagtgttaatatggctgattttgtccaagtgttgaacattaaggtaaactct
gagactcaacagcagctaaataaaataaaccttcctgctggaattttggcaacaggtgaa
aaacagacagatccatcaacaccacaacaggagtcttcgaaaccgttgggaggaattcag
ccttcttctcagaccatccagcctaaagtggagactgatgctgcccaggcggctgtgcag
agtgcatttgcagttctgttgactcagttaataaaggctcagcagtcaaagcagaaagat
gtgctactagaagagagggaaaatggatcgggacatgaagcgtcattacaactcaggcca
cctccagaacctagcactccggtgtcgggacaagatgacctcatccagcatcaagatatg
aggatcttggagctaacgccagaaccagaccggcctcgaattctgcctcctgaccaacga
cctcccgagcctcctgaaccaccaccagtcactgaggaagatctagattatcggacagaa
aaccagcatgtacccaccaccagttcttcattaactgaccctcatgccggagtgaaggca
gccctgttacagctgcttgctcagcatcagccccaggatgaccccaaaagagaaggtggg
attgattatcaagcaggagacacttacgtgtccacttcagactacaaggacaactttgga
tcctcttctttctcttctgctccttatgttagcaatgatggtctaggaagcagttctgct
ccaccactagaacgacgtagtttcattggaaattcagatattcagtctttggataactac
agtactgcttcatctcattctggtggtccacctcagccttctgccttttctgagtcattt
cccagttcagtagctggatatggagacatttacctcaatgctggtcccatgttgtttagt
ggagacaaggaccatagatttgaatatagccatggtcctattgcagtcctggcaaacagc
agtgacccttccacggggccagagagtactcatcctttgccagcaaagatgcacaactat
aactatggtggtaacttacaggaaaatccgagtggccccagcctcatgcatggacagacc
tggacttctcctgcccaaggacctggatattcacaaggatacaggggacatattagcaca
tcaactggcagaggcagaggcagagggttaccatactga

DBGET integrated database retrieval system