KEGG   Homo sapiens (human): 8625Help
Entry
8625              CDS       T01001                                 

Gene name
RFXANK, ANKRA1, BLS, F14150_1, RFX-B
Definition
(RefSeq) regulatory factor X associated ankyrin containing protein
  KO
K08062  
regulatory factor X-associated ankyrin-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
Antigen processing and presentation
Tuberculosis
Primary immunodeficiency
Disease
H00093  
Combined immunodeficiencies (CIDs)
H00985  
Bare lymphocyte syndrome (BLS) type2
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    8625 (RFXANK)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    8625 (RFXANK)
  Infectious diseases
   05152 Tuberculosis
    8625 (RFXANK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p12
AA seq 260 aa AA seqDB search
MELTQPAEDLIQTQQTPASELGDPEDPGEEAADGSDTVVLSLFPCTPEPVNPEPDASVSS
PQAGSSLKHSTTLTNRQRGNEVSALPATLDSLSIHQLAAQGELDQLKEHLRKGDNLVNKP
DERGFTPLIWASAFGEIETVRFLLEWGADPHILAKERESALSLASTGGYTDIVGLLLERD
VDINIYDWNGGTPLLYAVRGNHVKCVEALLARGADLTTEADSGYTPMDLAVALGYRKVQQ
VIENHILKLFQSNLVPADPE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggagcttacccagcctgcagaagacctcatccagacccagcagacccctgcctcagaa
cttggggaccctgaagaccccggagaggaggctgcagatggctcagacactgtggtcctc
agtctctttccctgcacccctgagcctgtgaatcctgaaccggatgccagtgtttcctct
ccacaggcaggcagctccctgaagcactccaccactctcaccaaccggcagcgagggaac
gaggtgtcagctctgccggccaccctagactccctgtccatccaccagctcgcagcacag
ggggagctggaccagctgaaggagcatttgcggaaaggtgacaacctcgtcaacaagcca
gacgagcgcggcttcacccccctcatctgggcctccgcctttggagagattgagaccgtt
cgcttcctgctggagtggggtgccgacccccacatcctggcaaaagagcgagagagcgcc
ctgtcgctggccagcacaggcggctacacagacattgtggggctgctgctggagcgtgac
gtggacatcaacatctatgattggaatggagggacgccactgctgtacgctgtgcgcggg
aaccacgtgaaatgcgttgaggccttgctggcccgaggcgctgacctcaccaccgaagcc
gactctggctacaccccgatggaccttgccgtggccctgggataccggaaagtgcaacag
gtgatcgagaaccacatcctcaagctcttccagagcaacctggtgcccgctgaccctgag
tga

DBGET integrated database retrieval system