KEGG   Homo sapiens (human): 8633Help
Entry
8633              CDS       T01001                                 

Gene name
UNC5C, UNC5H3
Definition
(RefSeq) unc-5 netrin receptor C
  KO
K07521  
netrin receptor unc-5
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    8633 (UNC5C)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Others
   ROBO4; roundabout, axon guidance receptor, homolog 4 (Drosophila) [KO:K06784]
    8633 (UNC5C)
 7. Others
  FLRT; leucine-rich repeat transmembrane protein FLRT [KO:K16362]
   8633 (UNC5C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O95185(Tbio)
UniProt: 
Position
4q22.3
AA seq 931 aa AA seqDB search
MRKGLRATAARCGLGLGYLLQMLVLPALALLSASGTGSAAQDDDFFHELPETFPSDPPEP
LPHFLIEPEEAYIVKNKPVNLYCKASPATQIYFKCNSEWVHQKDHIVDERVDETSGLIVR
EVSIEISRQQVEELFGPEDYWCQCVAWSSAGTTKSRKAYVRIAYLRKTFEQEPLGKEVSL
EQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCV
AKNIVAKRKSTTATVIVYVNGGWSTWTEWSVCNSRCGRGYQKRTRTCTNPAPLNGGAFCE
GQSVQKIACTTLCPVDGRWTPWSKWSTCGTECTHWRRRECTAPAPKNGGKDCDGLVLQSK
NCTDGLCMQTAPDSDDVALYVGIVIAVIVCLAISVVVALFVYRKNHRDFESDIIDSSALN
GGFQPVNIKAARQDLLAVPPDLTSAAAMYRGPVYALHDVSDKIPMTNSPILDPLPNLKIK
VYNTSGAVTPQDDLSEFTSKLSPQMTQSLLENEALSLKNQSLARQTDPSCTAFGSFNSLG
GHLIVPNSGVSLLIPAGAIPQGRVYEMYVTVHRKETMRPPMDDSQTLLTPVVSCGPPGAL
LTRPVVLTMHHCADPNTEDWKILLKNQAAQGQWEDVVVVGEENFTTPCYIQLDAEACHIL
TENLSTYALVGHSTTKAAAKRLKLAIFGPLCCSSLEYSIRVYCLDDTQDALKEILHLERQ
MGGQLLEEPKALHFKGSTHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHVWSGSQRNLHCT
FTLERFSLNTVELVCKLCVRQVEGEGQIFQLNCTVSEEPTGIDLPLLDPANTITTVTGPS
AFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQN
FPDGNLSMLAAVLEEMGRHETVVSLAAEGQY
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaaggtctgcgggcgacagcggcccgctgcggactgggactgggatacttgctg
caaatgctcgtgctacctgccctggccctgctcagcgccagcggcactggctccgccgcc
caagatgatgacttttttcatgaactcccagaaacttttccttctgatccacctgagcct
ctgccacatttccttattgagcctgaagaagcttatattgtgaagaataagcctgtgaac
ctgtactgtaaagcaagccctgccacccagatctatttcaagtgtaatagtgaatgggtt
catcagaaggaccacatagtagatgaaagagtagatgaaacttccggtctcattgtccgg
gaagtgagcattgagatttcgcgccagcaagtggaagaactctttggacctgaagattac
tggtgccagtgtgtggcctggagctccgcgggtaccacaaagagccggaaggcgtatgtg
cgcattgcatatctacggaagacatttgagcaggaacccctaggaaaggaagtgtctttg
gaacaggaagtcttactccagtgtcgaccacctgaagggatcccagtggctgaggtggaa
tggttgaaaaatgaagacataattgatcccgttgaagatcggaatttttatattactatt
gatcacaacctcatcataaagcaggcccgactctctgatactgcaaattacacctgtgtt
gccaaaaacattgttgccaagaggaaaagtacaactgccactgtcatagtctatgtcaac
ggtggctggtccacctggacggagtggtctgtgtgtaacagccgctgtggacgagggtat
cagaaacgtacaaggacttgtaccaacccggcaccactcaatgggggtgccttctgtgaa
gggcagagtgtgcagaaaatagcctgtactacgttatgcccagtggatggcaggtggacg
ccatggagcaagtggtctacttgtggaactgagtgcacccactggcgcaggagggagtgc
acggcgccagcccccaagaatggaggcaaggactgcgacggcctcgtcttgcaatccaag
aactgcactgatgggctttgcatgcagactgctcctgattcagatgatgttgctctctat
gttgggattgtgatagcagtgatcgtttgcctggcgatctctgtagttgtggccttgttt
gtgtatcggaagaatcatcgtgactttgagtcagatattattgactcttcggcactcaat
gggggctttcagcctgtgaacatcaaggcagcaagacaagatctgctggctgtaccccca
gacctcacgtcagctgcagccatgtacagaggacctgtctatgccctgcatgacgtctca
gacaaaatcccaatgaccaactctccaattctggatccactgcccaacctgaaaatcaaa
gtgtacaacacctcaggtgctgtcaccccccaagatgacctctctgagtttacgtccaag
ctgtcccctcagatgacccagtcgttgttggagaatgaagccctcagcctgaagaaccag
agtctagcaaggcagactgatccatcctgtaccgcatttggcagcttcaactcgctggga
ggtcaccttattgttcccaattcaggagtcagcttgctgattcccgctggggccattccc
caagggagagtctacgaaatgtatgtgactgtacacaggaaagaaactatgaggccaccc
atggatgactctcagacacttttgacccctgtggtgagctgtgggcccccaggagctctg
ctcacccgcccagtcgtcctcactatgcatcactgcgcagaccccaataccgaggactgg
aaaatactgctcaagaaccaggcagcacagggacagtgggaggatgtggtggtggtcggg
gaggaaaacttcaccaccccctgctacattcagctggatgcagaggcctgccacatcctc
acagagaacctcagcacctacgccctggtaggacattccaccaccaaagcggctgcgaag
cgcctcaagctggccatctttgggcccctgtgctgctcctcgctggagtacagcatccga
gtctactgtctggatgacacccaggatgccctgaaggaaattttacatcttgagagacag
atgggaggacagctcctagaagaacctaaggctcttcattttaaaggcagcacccacaac
ctgcgcctgtcaattcacgatatcgcccattccctctggaagagcaaattgctggctaaa
tatcaggaaattccattttaccatgtttggagtggatctcaaagaaacctgcactgcacc
ttcactctggaaagatttagcctgaacacagtggagctggtttgcaaactctgtgtgcgg
caggtggaaggagaagggcagatcttccagctcaactgcaccgtgtcagaggaacctact
ggcatcgatttgccgctgctggatcctgcgaacaccatcaccacggtcacggggcccagt
gctttcagcatccctctccctatccggcagaagctctgtagcagcctggatgccccccag
acgagaggccatgactggaggatgctggcccataagctgaacctggacaggtacttgaat
tactttgccaccaaatccagcccaactggcgtaatcctggatctttgggaagcacagaac
ttcccagatggaaacctgagcatgctggcagctgtcttggaagaaatgggaagacatgaa
acggtggtgtccttagcagcagaagggcagtattaa

DBGET integrated database retrieval system