KEGG   Homo sapiens (human): 864Help
Entry
864               CDS       T01001                                 

Gene name
RUNX3, AML2, CBFA3, PEBP2aC
Definition
runt-related transcription factor 3
Orthology
K09279  
runt-related transcription factor 3
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   Runt
    864 (RUNX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36
AA seq 429 aa AA seqDB search
MASNSIFDSFPTYSPTFIRDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGG
RARPEVRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTV
VTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATY
HRAIKVTVDGPREPRRHRQKLEDQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFS
SQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPYSATPSG
TSISSLSVAGMPATSRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGTSSGSYQFSMV
AGSSSGGDRSPTRMLASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPTALSTPGR
MDEAVWRPY
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgaacagcatcttcgactccttcccgacctactcgccgaccttcatccgcgac
ccaagcaccagccgccgcttcacacctccctccccggccttcccctgcggcggcggcggc
ggcaagatgggcgagaacagcggcgcgctgagcgcgcaggcggccgtggggcccggaggg
cgcgcccggcccgaggtgcgctcgatggtggacgtgctggcggaccacgcaggcgagctc
gtgcgcaccgacagccccaacttcctctgctccgtgctgccctcgcactggcgctgcaac
aagacgctgcccgtcgccttcaaggtggtggcattgggggacgtgccggatggtacggtg
gtgactgtgatggcaggcaatgacgagaactactccgctgagctgcgcaatgcctcggcc
gtcatgaagaaccaggtggccaggttcaacgaccttcgcttcgtgggccgcagtgggcga
gggaagagtttcaccctgaccatcactgtgttcaccaaccccacccaagtggcgacctac
caccgagccatcaaggtgaccgtggacggaccccgggagcccagacggcaccggcagaag
ctggaggaccagaccaagccgttccctgaccgctttggggacctggaacggctgcgcatg
cgggtgacaccgagcacacccagcccccgaggctcactcagcaccacaagccacttcagc
agccagccccagaccccaatccaaggcacctcggaactgaacccattctccgacccccgc
cagtttgaccgctccttccccacgctgccaaccctcacggagagccgcttcccagacccc
aggatgcattatcccggggccatgtcagctgccttcccctacagcgccacgccctcgggc
acgagcatcagcagcctcagcgtggcgggcatgccggccaccagccgcttccaccatacc
tacctcccgccaccctacccgggggccccgcagaaccagagcgggcccttccaggccaac
ccgtccccctaccacctctactacgggacatcctctggctcctaccagttctccatggtg
gccggcagcagcagtgggggcgaccgctcacctacccgcatgctggcctcttgcaccagc
agcgctgcctctgtcgccgccggcaacctcatgaaccccagcctgggcggccagagtgat
ggcgtggaggccgacggcagccacagcaactcacccacggccctgagcacgccaggccgc
atggatgaggccgtgtggcggccctactga

DBGET integrated database retrieval system