KEGG   Homo sapiens (human): 8644Help
Entry
8644              CDS       T01001                                 

Gene name
AKR1C3, DD3, DDX, HA1753, HAKRB, HAKRe, HSD17B5, PGFS, hluPGFS
Definition
(RefSeq) aldo-keto reductase family 1 member C3
  KO
K04119  
aldo-keto reductase family 1 member C3 [EC:1.1.1.51 1.1.1.188 1.1.1.213 1.1.1.357]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Folate biosynthesis
Metabolic pathways
Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    8644 (AKR1C3)
   00590 Arachidonic acid metabolism
    8644 (AKR1C3)
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    8644 (AKR1C3)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    8644 (AKR1C3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.51  3(or 17)beta-hydroxysteroid dehydrogenase
     8644 (AKR1C3)
    1.1.1.188  prostaglandin-F synthase
     8644 (AKR1C3)
    1.1.1.213  3alpha-hydroxysteroid 3-dehydrogenase (Re-specific)
     8644 (AKR1C3)
    1.1.1.357  3alpha-hydroxysteroid 3-dehydrogenase
     8644 (AKR1C3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P42330(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
10p15.1
AA seq 323 aa AA seqDB search
MDSKHQCLKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPM
SLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKP
GLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD
RNLHYFNSDSFASHPNYPYSDEY
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggattcaaaacatcagtgtttgaagctaaatgatggtcacttcatgcctgtcctggga
tttggcacctatgcacctccagaggttccgagaagtaaagctttggaggtcacaaaatta
gcaatagaagctgggttccgccatatagattctgctcatttatacaataatgaggagcag
gttggactggccatccgaagcaagattgcagatggcagtgtgaagagagaagacatattc
tacacttcaaagctttggtccacttttcatcgaccagagttggtccgaccagccttggaa
aactcactgaagaaagctcaattggactatgttgacctctatcttattcattctccaatg
tctctaaagccaggtgaggaactttcaccaacagatgaaaatggaaaagtaatatttgac
atagtggatctctgtaccacctgggaggccatggagaagtgtaaggatgcaggattggcc
aagtccattggggtgtcaaacttcaaccgcaggcagctggagatgatcctcaacaagcca
ggactcaagtacaagcctgtctgcaaccaggtagaatgtcatccgtatttcaaccggagt
aaattgctagatttctgcaagtcgaaagatattgttctggttgcctatagtgctctggga
tctcaacgagacaaacgatgggtggacccgaactccccggtgctcttggaggacccagtc
ctttgtgccttggcaaaaaagcacaagcgaaccccagccctgattgccctgcgctaccag
ctgcagcgtggggttgtggtcctggccaagagctacaatgagcagcgcatcagacagaac
gtgcaggtttttgagttccagttgactgcagaggacatgaaagccatagatggcctagac
agaaatctccactattttaacagtgatagttttgctagccaccctaattatccatattca
gatgaatattaa

DBGET integrated database retrieval system