KEGG   Homo sapiens (human): 8644Help
Entry
8644              CDS       T01001                                 

Gene name
AKR1C3, DD3, DDX, HA1753, HAKRB, HAKRe, HSD17B5, PGFS, hluPGFS
Definition
(RefSeq) aldo-keto reductase family 1, member C3 (EC:1.3.1.20 1.1.1.188 1.1.1.239 1.1.1.64 1.1.1.112 1.1.1.357)
  KO
K04119  
aldo-keto reductase family 1 member C3 [EC:1.1.1.51 1.1.1.188 1.1.1.213 1.1.1.357]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Metabolic pathways
Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    8644 (AKR1C3)
   00590 Arachidonic acid metabolism
    8644 (AKR1C3)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    8644 (AKR1C3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.51  3(or 17)beta-hydroxysteroid dehydrogenase
     8644 (AKR1C3)
    1.1.1.188  prostaglandin-F synthase
     8644 (AKR1C3)
    1.1.1.213  3alpha-hydroxysteroid 3-dehydrogenase (Re-specific)
     8644 (AKR1C3)
    1.1.1.357  3alpha-hydroxysteroid 3-dehydrogenase
     8644 (AKR1C3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
10p15-p14
AA seq 323 aa AA seqDB search
MDSKHQCLKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPM
SLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKP
GLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD
RNLHYFNSDSFASHPNYPYSDEY
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggattcaaaacatcagtgtttgaagctaaatgatggtcacttcatgcctgtcctggga
tttggcacctatgcacctccagaggttccgagaagtaaagctttggaggtcacaaaatta
gcaatagaagctgggttccgccatatagattctgctcatttatacaataatgaggagcag
gttggactggccatccgaagcaagattgcagatggcagtgtgaagagagaagacatattc
tacacttcaaagctttggtccacttttcatcgaccagagttggtccgaccagccttggaa
aactcactgaagaaagctcaattggactatgttgacctctatcttattcattctccaatg
tctctaaagccaggtgaggaactttcaccaacagatgaaaatggaaaagtaatatttgac
atagtggatctctgtaccacctgggaggccatggagaagtgtaaggatgcaggattggcc
aagtccattggggtgtcaaacttcaaccgcaggcagctggagatgatcctcaacaagcca
ggactcaagtacaagcctgtctgcaaccaggtagaatgtcatccgtatttcaaccggagt
aaattgctagatttctgcaagtcgaaagatattgttctggttgcctatagtgctctggga
tctcaacgagacaaacgatgggtggacccgaactccccggtgctcttggaggacccagtc
ctttgtgccttggcaaaaaagcacaagcgaaccccagccctgattgccctgcgctaccag
ctgcagcgtggggttgtggtcctggccaagagctacaatgagcagcgcatcagacagaac
gtgcaggtttttgagttccagttgactgcagaggacatgaaagccatagatggcctagac
agaaatctccactattttaacagtgatagttttgctagccaccctaattatccatattca
gatgaatattaa

DBGET integrated database retrieval system