KEGG   Homo sapiens (human): 8645Help
Entry
8645              CDS       T01001                                 

Gene name
KCNK5, K2p5.1, KCNK5b, TASK-2, TASK2
Definition
(RefSeq) potassium two pore domain channel subfamily K member 5
  KO
K04916  
potassium channel subfamily K member 5
Organism
hsa  Homo sapiens (human)
Pathway
Taste transduction
Protein digestion and absorption
Drug target
Procaine [DG:DG00298]: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04974 Protein digestion and absorption
    8645 (KCNK5)
  Sensory system
   04742 Taste transduction
    8645 (KCNK5)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNK, K2px.x
   8645 (KCNK5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21
AA seq 499 aa AA seqDB search
MVDRGPLLTSAIIFYLAIGAAIFEVLEEPHWKEAKKNYYTQKLHLLKEFPCLGQEGLDKI
LEVVSDAAGQGVAITGNQTFNNWNWPNAMIFAATVITTIGYGNVAPKTPAGRLFCVFYGL
FGVPLCLTWISALGKFFGGRAKRLGQFLTKRGVSLRKAQITCTVIFIVWGVLVHLVIPPF
VFMVTEGWNYIEGLYYSFITISTIGFGDFVAGVNPSANYHALYRYFVELWIYLGLAWLSL
FVNWKVSMFVEVHKAIKKRRRRRKESFESSPHSRKALQVKGSTASKDVNIFSFLSKKEET
YNDLIKQIGKKAMKTSGGGETGPGPGLGPQGGGLPALPPSLVPLVVYSKNRVPTLEEVSQ
TLRSKGHVSRSPDEEAVARAPEDSSPAPEVFMNQLDRISEECEPWDAQDYHPLIFQDASI
TFVNTEAGLSDEETSKSSLEDNLAGEESPQQGAEAKAPLNMGEFPSSSESTFTSTESELS
VPYEQLMNEYNKANSPKGT
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggtggaccggggccctctgctcacctcggccatcatcttctacctggccatcggggcg
gcgatcttcgaagtgctggaggagccacactggaaggaggccaagaaaaactactacaca
cagaagctgcatctgctcaaggagttcccgtgcctgggtcaggagggcctggacaagatc
ctagaggtggtatctgatgctgcaggacagggtgtggccatcacagggaaccagaccttc
aacaactggaactggcccaatgcaatgatttttgcagcgaccgtcattaccaccattgga
tatggcaatgtggctcccaagacccccgccggtcgcctcttctgtgttttctatggtctc
ttcggggtgccgctctgcctgacgtggatcagtgccctgggcaagttcttcgggggacgt
gccaagagactagggcagttccttaccaagagaggtgtgagtctgcggaaggcgcagatc
acgtgcacagtcatcttcatcgtgtggggcgtcctagtccacctggtgatcccacccttc
gtattcatggtgactgaggggtggaactacatcgagggcctctactactccttcatcacc
atctccaccatcggcttcggtgactttgtggccggtgtgaaccccagcgccaactaccac
gccctgtaccgctacttcgtggagctctggatctacttggggctggcctggctgtccctt
tttgtcaactggaaggtgagcatgtttgtggaagtccacaaagccattaagaagcggcgg
cggcgacggaaggagtcctttgagagctccccacactcccggaaggccctgcaggtgaag
gggagcacagcctccaaggacgtcaacatcttcagctttctttccaagaaggaagagacc
tacaacgacctcatcaagcagatcgggaagaaggccatgaagacaagcgggggtggggag
acgggcccgggcccagggctggggcctcaaggcggtgggctcccagcactgcccccttcc
ctggtgcccctggtagtctactccaagaaccgggtgcccaccttggaagaggtgtcacag
acactgaggagcaaaggccacgtatcaaggtccccagatgaggaggctgtggcacgggcc
cctgaagacagctcccctgcccccgaggtgttcatgaaccagctggaccgcatcagcgag
gaatgcgagccatgggacgcccaggactaccacccactcatcttccaggacgccagcatc
accttcgtgaacacggaggctggcctctcagacgaggagacctccaagtcctcgctagag
gacaacttggcaggggaggagagcccccagcagggggctgaagccaaggcgcccctgaac
atgggcgagttcccctcctcctccgagtccaccttcaccagcactgagtctgagctctct
gtgccttacgaacagctgatgaatgagtacaacaaggctaacagccccaagggcacatga

DBGET integrated database retrieval system