KEGG   Homo sapiens (human): 8646Help
Entry
8646              CDS       T01001                                 

Gene name
CHRD
Definition
chordin
Orthology
K04657  
chordin
Organism
hsa  Homo sapiens (human)
Pathway
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    8646 (CHRD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q27
AA seq 955 aa AA seqDB search
MPSLPAPPAPLLLLGLLLLGSRPARGAGPEPPVLPIRSEKEPLPVRGAAGCTFGGKVYAL
DETWHPDLGEPFGVMRCVLCACEAPQWGRRTRGPGRVSCKNIKPECPTPACGQPRQLPGH
CCQTCPQERSSSERQPSGLSFEYPRDPEHRSYSDRGEPGAEERARGDGHTDFVALLTGPR
SQAVARARVSLLRSSLRFSISYRRLDRPTRIRFSDSNGSVLFEHPAAPTQDGLVCGVWRA
VPRLSLRLLRAEQLHVALVTLTHPSGEVWGPLIRHRALAAETFSAILTLEGPPQQGVGGI
TLLTLSDTEDSLHFLLLFRGLLEPRSGGLTQVPLRLQILHQGQLLRELQANVSAQEPGFA
EVLPNLTVQEMDWLVLGELQMALEWAGRPGLRISGHIAARKSCDVLQSVLCGADALIPVQ
TGAAGSASLTLLGNGSLIYQVQVVGTSSEVVAMTLETKPQRRDQRTVLCHMAGLQPGGHT
AVGICPGLGARGAHMLLQNELFLNVGTKDFPDGELRGHVAALPYCGHSARHDTLPVPLAG
ALVLPPVKSQAAGHAWLSLDTHCHLHYEVLLAGLGGSEQGTVTAHLLGPPGTPGPRRLLK
GFYGSEAQGVVKDLEPELLRHLAKGMASLMITTKGSPRGELRGQVHIANQCEVGGLRLEA
AGAEGVRALGAPDTASAAPPVVPGLPALAPAKPGGPGRPRDPNTCFFEGQQRPHGARWAP
NYDPLCSLCTCQRRTVICDPVVCPPPSCPHPVQAPDQCCPVCPEKQDVRDLPGLPRSRDP
GEGCYFDGDRSWRAAGTRWHPVVPPFGLIKCAVCTCKGGTGEVHCEKVQCPRLACAQPVR
VNPTDCCKQCPVGSGAHPQLGDPMQADGPRGCRFAGQWFPESQSWHPSVPPFGEMSCITC
RCGAGVPHCERDDCSLPLSCGSGKESRCCSRCTAHRRPAPETRTDPELEKEAEGS
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atgccgagcctcccggccccgccggccccgctgctgctcctcgggctgctgctgctcggc
tcccggccggcccgcggcgccggcccagagccccccgtgctgcccatccgttctgagaag
gagccgctgcccgttcggggagcggcaggctgcaccttcggcgggaaggtctatgccttg
gacgagacgtggcacccggacctaggggagccattcggggtgatgcgctgcgtgctgtgc
gcctgcgaggcgcctcagtggggtcgccgtaccaggggccctggcagggtcagctgcaag
aacatcaaaccagagtgcccaaccccggcctgtgggcagccgcgccagctgccgggacac
tgctgccagacctgcccccaggagcgcagcagttcggagcggcagccgagcggcctgtcc
ttcgagtatccgcgggacccggagcatcgcagttatagcgaccgcggggagccaggcgct
gaggagcgggcccgtggtgacggccacacggacttcgtggcgctgctgacagggccgagg
tcgcaggcggtggcacgagcccgagtctcgctgctgcgctctagcctccgcttctctatc
tcctacaggcggctggaccgccctaccaggatccgcttctcagactccaatggcagtgtc
ctgtttgagcaccctgcagcccccacccaagatggcctggtctgtggggtgtggcgggca
gtgcctcggttgtctctgcggctccttagggcagaacagctgcatgtggcacttgtgaca
ctcactcacccttcaggggaggtctgggggcctctcatccggcaccgggccctggctgca
gagaccttcagtgccatcctgactctagaaggccccccacagcagggcgtagggggcatc
accctgctcactctcagtgacacagaggactccttgcattttttgctgctcttccgaggg
ctgctggaacccaggagtgggggactaacccaggttcccttgaggctccagattctacac
caggggcagctactgcgagaacttcaggccaatgtctcagcccaggaaccaggctttgct
gaggtgctgcccaacctgacagtccaggagatggactggctggtgctgggggagctgcag
atggccctggagtgggcaggcaggccagggctgcgcatcagtggacacattgctgccagg
aagagctgcgacgtcctgcaaagtgtcctttgtggggctgatgccctgatcccagtccag
acgggtgctgccggctcagccagcctcacgctgctaggaaatggctccctgatctatcag
gtgcaagtggtagggacaagcagtgaggtggtggccatgacactggagaccaagcctcag
cggagggatcagcgcactgtcctgtgccacatggctggactccagccaggaggacacacg
gccgtgggtatctgccctgggctgggtgcccgaggggctcatatgctgctgcagaatgag
ctcttcctgaacgtgggcaccaaggacttcccagacggagagcttcgggggcacgtggct
gccctgccctactgtgggcatagcgcccgccatgacacgctgcccgtgcccctagcagga
gccctggtgctaccccctgtgaagagccaagcagcagggcacgcctggctttccttggat
acccactgtcacctgcactatgaagtgctgctggctgggcttggtggctcagaacaaggc
actgtcactgcccacctccttgggcctcctggaacgccagggcctcggcggctgctgaag
ggattctatggctcagaggcccagggtgtggtgaaggacctggagccggaactgctgcgg
cacctggcaaaaggcatggcctccctgatgatcaccaccaagggtagccccagaggggag
ctccgagggcaggtgcacatagccaaccaatgtgaggttggcggactgcgcctggaggcg
gccggggccgagggggtgcgggcgctgggggctccggatacagcctctgctgcgccgcct
gtggtgcctggtctcccggccctagcgcccgccaaacctggtggtcctgggcggccccga
gaccccaacacatgcttcttcgaggggcagcagcgcccccacggggctcgctgggcgccc
aactacgacccgctctgctcactctgcacctgccagagacgaacggtgatctgtgacccg
gtggtgtgcccaccgcccagctgcccacacccggtgcaggctcccgaccagtgctgccct
gtttgccctgagaaacaagatgtcagagacttgccagggctgccaaggagccgggaccca
ggagagggctgctattttgatggtgaccggagctggcgggcagcgggtacgcggtggcac
cccgttgtgcccccctttggcttaattaagtgtgctgtctgcacctgcaaggggggcact
ggagaggtgcactgtgagaaggtgcagtgtccccggctggcctgtgcccagcctgtgcgt
gtcaaccccaccgactgctgcaaacagtgtccagtggggtcgggggcccacccccagctg
ggggaccccatgcaggctgatgggccccggggctgccgttttgctgggcagtggttccca
gagagtcagagctggcacccctcagtgcccccttttggagagatgagctgtatcacctgc
agatgtggggcaggggtgcctcactgtgagcgggatgactgttcactgccactgtcctgt
ggctcggggaaggagagtcgatgctgttcccgctgcacggcccaccggcggccagcccca
gagaccagaactgatccagagctggagaaagaagccgaaggctcttag

DBGET integrated database retrieval system