KEGG   Homo sapiens (human): 8649Help
Entry
8649              CDS       T01001                                 

Gene name
LAMTOR3, MAP2K1IP1, MAPBP, MAPKSP1, MP1, PRO0633, Ragulator3
Definition
late endosomal/lysosomal adaptor, MAPK and MTOR activator 3
Orthology
K04370  
mitogen-activated protein kinase kinase 1 interacting protein 1
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    8649 (LAMTOR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q23
AA seq 117 aa AA seqDB search
MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKEHALRPGFLSTFALATDQGSKLGLSK
NKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggcggatgacctaaagcgattcttgtataaaaagttaccaagtgttgaagggctccat
gccattgttgtgtcagatagagatggagtacctgttattaaagagcatgctttgcgacct
ggtttcttatccacttttgcccttgcaacagaccaaggaagcaaacttggactttccaaa
aataaaagtatcatctgttactataacacctaccaggtggttcaatttaatcgtttacct
ttggtggtgagtttcatagccagcagcagtgccaatacaggactaattgtcagcctagaa
aaggaacttgctccattgtttgaagaactgagacaagttgtggaagtttcttaa

DBGET integrated database retrieval system