KEGG   Homo sapiens (human): 8650Help
Entry
8650              CDS       T01001                                 

Gene name
NUMB, C14orf41, S171, c14_5527
Definition
numb homolog (Drosophila)
Orthology
K06057  
numb
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:hsa04330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q24.3
AA seq 651 aa AA seqDB search
MNKLRQSFRRKKDVYVPEASRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICED
AVKRLKAERKFFKGFFGKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPD
RNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTA
TFDASRTTFTREGSFRVTTATEQAEREEIMKQMQDAKKAETDKIVVGSSVAPGNTAPSPS
SPTSPTSDATTSLEMNNPHAIPRRHAPIEQLARQGSFRGFPALSQKMSPFKRQLSLRINE
LPSTMQRKTDFPIKNAVPEVEGEAESISSLCSQITNAFSTPEDPFSSAPMTKPVTVVAPQ
SPTFQANGTDSAFHVLAKPAHTALAPVAMPVRETNPWAHAPDAANKEIAATCSGTEWGQS
SGAASPGLFQAGHRRTPSEADRWLEEVSKSVRAQQPQASAAPLQPVLQPPPPTAISQPAS
PFQGNAFLTSQPVPVGVVPALQPAFVPAQSYPVANGMPYPAPNVPVVGITPSQMVANVFG
TAGHPQAAHPHQSPSLVRQQTFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASA
DRHTEVPTGTCPVDPFEAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIEL
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaattacggcaaagttttaggagaaagaaggatgtttatgttccagaggccagt
cgtccacatcagtggcagacagatgaagaaggcgttcgcaccggaaaatgtagcttcccg
gttaagtaccttggccatgtagaagttgatgaatcaagaggaatgcacatctgtgaagat
gctgtaaaaagattgaaagctgaaaggaagttcttcaaaggcttctttggaaaaactgga
aagaaagcagttaaagcagttctgtgggtctcagcagatggactcagagttgtggatgaa
aaaactaaggacctcatagttgaccagacgatagagaaagtttctttctgtgccccagac
aggaactttgatagagccttttcttacatatgccgtgatggcaccactcgtcgctggatc
tgtcactgcttcatggctgtcaaggacacaggtgaaaggttgagccatgcagtaggctgt
gcttttgcagcctgtttagagcgcaagcagaagcgggagaaggaatgtggagtgactgct
acttttgatgctagtcggaccacttttacaagagaaggatcattccgtgtcacaacagcc
actgaacaagcagaaagagaggagatcatgaaacaaatgcaagatgccaagaaagctgaa
acagataagatagtcgttggttcatcagttgcccctggcaacactgccccatccccatcc
tctcccacctctcctacttctgatgccacgacctctctggagatgaacaatcctcatgcc
atcccacgccggcatgctccaattgaacagcttgctcgccaaggctctttccgaggtttt
cctgctcttagccagaagatgtcaccctttaaacgccaactatccctacgcatcaatgag
ttgccttccactatgcagaggaagactgatttccccattaaaaatgcagtgccagaagta
gaaggggaggcagagagcatcagctccctgtgctcacagatcaccaatgccttcagcaca
cctgaggaccccttctcatctgctccgatgaccaaaccagtgacagtggtggcaccacaa
tctcctaccttccaagctaatggcactgactcagccttccatgtgcttgctaagccagcc
catactgctctagcacccgtagcaatgcctgtgcgtgaaaccaacccttgggcccatgcc
cctgatgctgctaacaaggaaattgcagccacatgttcggggaccgagtggggtcaatct
tctggtgctgcctctccaggtctcttccaggccggtcatagacgtactccctctgaggcc
gaccgatggttagaagaggtgtctaagagcgtccgggctcagcagccccaggcctcagct
gctcctctgcagccagttctccagcctcctccacccactgccatctcccagccagcatca
cctttccaagggaatgcattcctcacctctcagcctgtgccagtgggtgtggtcccagcc
ctgcaaccagcctttgtccctgcccagtcctatcctgtggccaatggaatgccctatcca
gcccctaatgtgcctgtggtgggcatcactccctcccagatggtggccaacgtatttggc
actgcaggccaccctcaggctgcccatccccatcagtcacccagcctggtcaggcagcag
acattccctcactacgaggcaagcagtgctaccaccagtcccttctttaagcctcctgct
cagcacctcaacggttctgcagctttcaatggtgtagatgatggcaggttggcctcagca
gacaggcatacagaggttcctacaggcacctgcccagtggatccttttgaagcccagtgg
gctgcattagaaaataagtccaagcagcgtactaatccctcccctaccaaccctttctcc
agtgacttacagaagacgtttgaaattgaactttaa

DBGET integrated database retrieval system